close

Se connecter

Se connecter avec OpenID

Activités scientifiques informatisées

IntégréTéléchargement
TECHNOLOGIES NOUVELLES ET ÉDUCATION
Sciences de la Vie et de la Terre au Lycée
Activités scientifiques
informatisées
Visualiser - Analyser - Modéliser
N. SALAMÉ
(sous la direction de)
Institut National de Recherche
Pédagogique
DEPARTEMENT TECHNOLOGIES NOUVELLES ET EDUCATION
Sciences de la Vie et de la Terre
Au Lycée
Activités Scientifiques
Informatisées
Visualiser - Analyser - Modéliser
(sous la direction de N. Salamé)
INSTITUT NATIONAL DE RECHERCHE PEDAGOGIQUE
© INRP, 1992
ISBN : 2-7342-0352-9
Préface
L'évolution du Savoir universitaire conditionne celle des contenus
d'enseignement des Sciences de la Vie et de la Terre, au Collège et au Lycée.
Or, les progrès dans les connaissances scientifiques sont étroitement liés au
perfectionnement des techniques d'investigation des phénomènes biologiques et
géologiques, toujours complexes. La Recherche et l'Industrie font actuellement
appel à des technologies et méthodes indirectes d'exploration et de mesure de
ces phénomènes. L'ordinateur est donc le moyen d'accès aux objets étudiés,
dans de nombreux domaines.
En recherchant les transpositions possibles des applications de
l'informatique vers l'enseignement secondaire, l'INRP ouvre une voie de
renouvellement des activités pratiques et expérimentales des élèves.
L'articulation entre les connaissances de base et la maîtrise des instruments
informatiques représente, en effet, une nouvelle modalité de construction de
leur savoir par les élèves, dans une attitude active de recherche des solutions à
un problème posé. Au delà, cette recherche induit une réflexion fondamentale
sur la formation initiale des enseignants.
Le protocole conçu et conduit par l'Institut a nécessité un très important
travail d'identification des transferts possibles, auprès des laboratoires des
grands organismes scientifiques, de l'Université et de l'Industrie, dans de
multiples disciplines : Physique, Chimie, Géophysique, Hydrogéologie,
Génétique moléculaire, Physiologie végétale et animale, etc. Des liens étroits
avec des équipes d'enseignants travaillant en réseau ont permis
l'expérimentation dans les classes de logiciels et de matériels adaptés.
L'application pédagogique a induit une réflexion sur l'intégration des
nouveaux outils dans les démarches pédagogiques et la diversification des
méthodes d'enseignement.
Bref, la démarche de recherche ainsi orientée et basée sur une conjonction
d'efforts et sur la complémentarité des apports entre chercheurs,
professionnels et éducateurs, a abouti aux résultats extrêmement riches et
d'intérêt national qui sont réunis dans cette publication.
La valorisation et la modernisation de l'enseignement scientifique est une
priorité nationale. Aussi, on a recherché le renforcement de la motivation des
élèves et de la valeur formatrice de la discipline dans sa spécificité : la
formation au mode de pensée expérimental. Dans les situations proposées,
l'élève, dans une attitude active et en utilisant des technologies modernes,
réalise une production scientifique, individuellement ou en équipe, et acquiert
des savoir-faire méthodologiques et techniques. Il est sensibilisé aux démarches
de modélisation par le traitement de données et la simulation. Les types
d'applications pédagogiques de l'ordinateur concernent aussi l'exploitation de
logiciels professionnels d'aide à la décision (agronomie, gestion des
r e s s o u r c e s ) , l'expérimentation assistée par ordinateur, l'imagerie
informatique, ainsi que l'emploi de bases de données et de logiciels de
traitement, par exemple en génétique moléculaire.
L'utilisation pédagogique de l'informatique est en voie de généralisation,
notamment sous l'impulsion de la Direction des Lycées et Collèges et de
l'Inspection générale. Le travail sur les logiciels trouve sa place en salle de
travaux pratiques de Biologie-Géologie et les équipements spécifiques des
laboratoires progressent.
Aussi, cet aspect de la recherche conduite dans le Département Technologies
Nouvelles et Education de l'INRP est exemplaire. L'Inspection générale de
Biologie-Géologie remercie l'équipe des chercheurs et enseignants qui ont
apporté leur contribution à cet excellent travail et qui, avec une très grande
compétence, ont su comprendre l'ambition éducative de notre enseignement et
proposer de nouveaux moyens de renouvellement des contenus à enseigner et
aussi des méthodes d'enseignement. De plus, ce travail d'équipe ouvre la
réflexion sur le terrain privilégié des nouvelles conditions de la relation
pédagogique entre le professeur et les élèves dans la classe : c'est un aspect
essentiel.
Cette recherche fondamentale et appliquée contribuera à améliorer les
pratiques pédagogiques de l'ensemble des enseignants de la discipline ; la
formation initiale, dans les Instituts Universitaires, s'inspirera du coeur de
cette recherche : l'interdépendance entre le Savoir relatif aux phénomènes
naturels et les nouveaux moyens de leur exploration et de leur mesure.
Régis DEMOUNEM
Doyen de l'Inspection Générale
de Biologie-Géologie
EQUIPES
ASSOCIEES A LA RECHERCHE
Les textes qui suivent sont issus, pour une large part, du travail de synthèse
réalisé par les animateurs des équipes :
- Christiane Haguenauer, Nancy
- Jean-Marc Coulais, Niort
- Michel Dreyer, Strasbourg
- Jean-Yves Dupont, Tours
- Suzanne Dupouy et Christian Gros, Toulouse
- Jean-François Schmit, Fameck
- Bernard Thérrié, Evry
Composition des équipes :
TENTATIVE D E MODELISATION DE LA LITHOSPHERE
DANS LES ZONES DE SUBDUCTION
R. Culos, MAFPEN de Toulouse
S. Dupouy, Lycée Saint Sernin, Toulouse
C. Gros, Lycée Fermât, Toulouse
C O M P R E N D R E E T PRÉVOIR LA DYNAMIQUE
DES NAPPES D'EAU
J. Baly, Lycée Xavier Bichat, Luné ville
P. Berche, Lycée Henri Poincaré, Nancy
J.-Y. Boulanger, Lycée Jacques Callot, Nancy
B. Gérardin, Lycée Jeanne d'Arc, Nancy
C. Haguenauer, MAFPEN et IUFM de Nancy-Metz
Bl. Janin, Collège de Dieulouard
S. Klein, Collège de Mirecourt
LA GESTION DES RESSOURCES EN EAU
A p p r o c h e à p a r t i r des données et des logiciels g é n é r a u x
J J . Bernard, Lycée Camille Guérin, Poitiers
J.M. Coulais, Lycée de la Venise Verte, Niort
J. Coutable, Lycée Pilote Innovant, Jaunay-Clan
P. Giraudeau, Lycée Pilote Innovant, Jaunay-Clan
GESTION DES RESSOURCES VEGETALES ET ANIMALES
E x p l o i t a t i o n p é d a g o g i q u e des logiciels p r o f e s s i o n n e l s
d'aide à la décision
A. Barrère, Lycée d'Enseignement Agricole Tours-Fondettes
J. Barrère, Lycée Paul Louis Courier, Tours
J.Y. Dupont, Lycée Paul Louis Courier, Tours
B. Moulia, Lycée d'Enseignement Agricole Tours-Fondettes
SUIVI MULTIPARAMETRE DE MILIEUX
BIOLOGIQUES COMPLEXES
G. Chambon, Lycée St Exupéry, Fameck
P. Faure, Lycée St Exupéry, Fameck
G. Orsini,Lycée St Exupéry, Fameck
J.F. Schmit, Lycée St Exupéry, Fameck
LA TRANSMISSION DE L'INFORMATION DANS L'ORGANISME
Logiciels d e s i m u l a t i o n en neurophysiologie
M. Dreyer, Lycée Fustel de Coulanges, Strasbourg
J.C Hervé, IPR-IA de biologie-géologie, Académie de Versailles
N. Salamé, INRP, Département Technologies Nouvelles et Education
ANALYSE DE SEQUENCES DE GENES ET DE PROTEINES
J. C. Hervé, IPR-IA, Académie de Versailles
D. Lenne, Département Technologies Nouvelles et Education
N. Salamé, INRP, Département Technologies Nouvelles et Education
J.F. Rodes, Lycée Francisque Sarcey, Dourdan
B. Thérrié, Lycée du Parc des Loges, Evry
La mise en forme de toutes les illustrations graphiques a été réalisée par
G. Boghossian, graphiste à l'INRP.
Sommaire
page
INTRODUCTION
N. Salamé
17
TENTATIVE D E MODELISATION DE LA LITHOSPHERE
DANS LES ZONES DE SUBDUCTION
21
R. Culos, S. Dupouy, C. Gros
I. LES ORIENTATIONS PEDAGOGIQUES
A. Le contexte
B. Les approches antérieures
C. Les objectifs
IL LES LOGICIELS ET LES DONNEES DISPONIBLES
A. Les logiciels recensés
1. Logiciels commerciaux de visualisation graphique
2. Les logiciels de modélisation
B. Les données disponibles
1. Nature et origine des données recueillies :
2. Format, volume et préparation des données :
C. Les logiciels utilisés
1. SURFER : logiciel de traitement et de visualisation graphique
2. GRAMMAG : logiciel de modélisation graphique
3. COUPER : logiciel de réalisation de profils
4. POLYDES : logiciel de visualisation des séismes
5. MENUGEO : module intégrateur
EL LA DEMARCHE PEDAGOGIQUE
A.
B.
C.
D.
Présentation géographique
Bathymétrie
Mise en évidence d'une relation bathymétrie-gravimétrie
Recherche de données complémentaires
1. Données de sismique naturelle
2. Données de sismique réflexion-réfraction
E. Elaboration du modèle
1. Réalisation de l'ébauche sur papier
2. Transfert du modèle sur machine
F. Synthèse : le modèle dynamique
IV. DISCUSSION
A. Les données
B. Les logiciels
C. Le travail du professeur
D. Les réactions des élèves
E. Les contenus et les programmes
F. Les perspectives
24
24
25
27
28
28
28
29
30
30
32
34
35
39
43
44
45
48
48
49
52
54
54
57
59
59
59
61
63
63
63
66
66
68
69
C O M P R E N D R E E T P R E V O I R LA D Y N A M I Q U E
DES NAPPES D'EAU
73
J. Baly, P. Berche, J.-Y. Boulanger, B. Gérardin
C. H a g u e n a u e r , Bl. Janin, S. Klein
I. APPLICATIONS DE L'INFORMATIQUE EN GEOLOGIE APPLIQUEE
ET PLUS PRECISEMENT EN HYDROGEOLOGIE
A. La géologie appliquée, science prospective
B. L'hydrogéologie, science des modèles
C. Place de la géologie appliquée, particulièrement
de l'hydrogéologie, dans l'enseignement secondaire
II. ADAPTATION D'OUTILS PROFESSIONNELS ET CONSTRUCTION
D'UN NOUVEL OUTIL POUR L'ENSEIGNEMENT
A. Accessibilité des outils professionnels,
traditionnels et informatiques
B. Adaptation d'HYDROMOD, logiciel à caractère professionnel
1. Définition du modèle
2. Adaptation pédagogique d'HYDROMOD
conduisant au logiciel HYDROS.
3. Le menu et les principales fonctions d'HYDROS.
C. Création d'ÉCO L'EAU, un outil spécialisé
adapté au milieu scolaire
1. Définition du modèle
2. Structuration pédagogique d'ÉCO L'EAU
III. APPLICATION PÉDAGOGIQUE DES OUTILS ADAPTÉS
A.Utilisation du logiciel HYDROS pour comprendre et représenter
dans l'espace la dynamique d'une nappe
1. Activités des élèves
2. Évaluation des résultats de l'expérimentation
d'HYDROS en classe
B. Utilisation du logiciel ECO L'EAU pour comprendre
et représenter la dynamique temporelle d'une nappe d'eau
1. Activités des élèves
2. Évaluation des résultats de l'expérimentation
d'ÉCO L'EAU en classe
C. Perspectives offertes par les logiciels
ECO L'EAU et HYDROS
75
75
78
81
84
84
85
85
87
90
93
93
97
105
105
105
113
120
120
130
138
LA GESTION DES RESSOURCES EN EAU
A p p r o c h e à p a r t i r d e s d o n n é e s et des logiciels g é n é r a u x
141
J J . Bernard, J . M . Coulais, J. Coutable, P. Giraudeau
I. L'APPROCHE D U PROBLEME
143
A. Les types de logiciels disponibles
B. Les données à recueillir
C. Les documents d'appuis
144
145
146
D. Les orientations de travail
146
H. LES BESOINS ET USAGES DE L'EAU
148
A. Thème d'étude : alimentation en eau potable,
organisation des unités de distribution.
1. Objectifs pédagogiques
2. Collecte et saisie des informations
3. Traitement de l'information
ffl. LES FLUX D'EAU ET LEUR GESTION
A. Objectifs pédagogiques communs aux différents thèmes d'étude
1. Problèmes à étudier
2. Savoirs
3. Savoir-faire
B. Collecte et saisie des informations
1. Organismes compétents
C. Les Thèmes d'étude
1. Thème : mise en évidence d'un flux et de ses variations
a. Exemple d'acquisition et d'utilisation de données expérimentales
b. Travail à partir de fichiers de données professionnelles
2. Thème : la gestion des flux d'eau
148
148
148
150
154
154
154
154
154
155
155
155
157
157
159
162
IV. L'EAU ET LES FLUX D E MATIERE
164
A. Objectifs pédagogiques communs, aux différents thèmes d'étude
1. Problèmes à étudier
2. Savoirs
B. La collecte des informations
1. Les paramètres de qualité
2. Organismes compétents
C. Le traitement des informations
1. Les données
2. Les logiciels
D. Les thèmes d'étude
1. Thème : étude des normes de potabilité à partir des fichiers de qualité
2. Thème : Qualité d'une eau et répartition géographique : la cartographie
3. Thème : Qualité et potabilité d'une eau
4. Thème : Corrélations entre paramètres de qualité des eaux
164
164
164
164
164
165
166
166
167
167
167
169
176
178
IV - CONCLUSIONS
180
ANNEXES
183
GESTION DES RESSOURCES VEGETALES ET ANIMALES
E x p l o i t a t i o n p é d a g o g i q u e des logiciels
p r o f e s s i o n n e l s d'aide à la décision
191
A. Barrère, J. Barrère, J.Y. Dupont, B. Moulia
I. L'INFORMATIQUE D A N S LE MONDE AGRICOLE
194
A. Les Logiciels disponibles
1. Production végétale
2. Production animale
B. La collaboration avec l'enseignement agricole
195
195
196
197
IL LOGICIELS CHOISIS. FONCTIONNALITES
ET UTILISATION PEDAGOGIQUE
198
A. Fertilisation minérale : le logiciel ISAFUMURE
1. Fonctionnalités
2. Utilisation pédagogique
a. Activités sur le terrain et en T.P.
b. Utilisation du logiciel
3. Les étapes du travail
a. Les exportations minérales
b. Les caractéristiques du sol
c. Amélioration de la fertilité des sol
198
198
199
200
200
201
201
202
205
B. Rationalisation de l'irrigation : le logiciel LORA
1. Fonctionnalités
2. Utilisation pédagogique
a.Les besoins en eau des plantes
b. Les réserves en eau du sol
c. L'adéquation besoins-ressources
205
205
207
207
209
210
C. Nutrition animale : le logiciel DIETAL
1. Fonctionnalités
2. La nutrition en vue de la production de lait
3. La physiologie des ruminants
4. Le rationnement en stabulation libre
a. La valeur nutritive des aliments
b. Equilibrer les apports alimentaires
c. Eviter le prélèvement sur le squelette
d. Accroître la production lactée
5. La nutrition en pâturage
a. L'évolution de la prairie dans le temps
b. La valeur alimentaire des fourrages
213
213
213
214
217
217
218
219
219
220
222
223
III. SYNTHESE
224
ANNEXE
227
SUIVI M U L T I P A R A M E T R E
DE MILIEUX BIOLOGIQUES COMPLEXES
EXEMPLE : LA FERMENTATION
229
G Chambon, G. Orsini, P. Faure, J.F. Schmit
I. LES ASPECTS PEDAGOGIQUES
A. Les savoirs
1. En biologie
2. En chimie
3. En physique
B. Les savoir-faire
IL LE SUIVI TECHNIQUE D'UNE FERMENTATION
A. Dans l'industrie
1. Les fermenteurs
2. Les capteurs
3. Les échantillonneurs
4. les dosages
B. Dans l'enseignement
1. Les matériels disponibles
III. MISE A U POINT DES EXPERIENCES
A. Contrôle des conditions de pH et de température
1. Essai 1 à température ambiante
2. Essai 2 à une température plus élevée
B. Régulation du pH et de la température
C. Dosages du glucose
D. Dosages de l'alcool
IV - MISE EN OEUVRE D A N S LES CLASSES
A. Séquence d'initiation
1. Objectifs
2. Principe du T.P.
3. Résultats
B. Séquence de transfert
1. Principe du T.P.
2. Protocole expérimental
3. Consignes
231
232
232
233
233
234
234
234
234
234
235
235
235
235
236
237
238
239
241
241
242
243
243
243
243
244
244
244
244
245
V. CONCLUSIONS ET PERSPECTIVES
246
ANNEXE
248
LA TRANSMISSION DE L'INFORMATION DANS L'ORGANISME
L o g i c i e l s d e s i m u l a t i o n en physiologie n e r v e u s e
251
M. Dreyer, J.C. Hervé, N., Salamé
I. L'EVOLUTION DES CONTENUS
253
II. LOGICIELS DISPONIBLES EN PHYSIOLOGIE NERVEUSE
255
A. Fonctions générales des logiciels
1. HHE
2. AXOVACS
3. NEUROSIM
B. Fonctions communes, fonctions spécifiques
C. Etude comparée de quelques résultats expérimentaux
D. Autres logiciels disponibles
III. ETUDE DU SYSTEME NERVEUX AVEC LE LOGICIEL NEUROSIM
A. Problématique générale
B. Prérequis des élèves
C. Les étapes de la démarche
1. Le concept de potentiel d'action
2. La période réfractaire
3. Recherche des mécanismes ioniques
à l'origine du potentiel d'action
4. Recherche d'explications aux caractéristiques essentielles
du signal nerveux
5. Modalités de passage des ions Sodium et Potassium
au cours du potentiel d'action
6. Introduction à la notion de canaux ioniques
7. La conduction du message nerveux
8. La transmission de l'information au niveau des synapses
et le rôle intégrateur du neurone
IV. APPROCHES COMPLEMENTAIRES
A. Phénomènes ioniques de la membrane neuronale
B. Les aspects énergétiques
C. Les aspects moléculaires
256
256
257
259
261
262
263
263
264
265
265
265
267
268
270
272
275
275
277
281
281
284
285
ANALYSE DE SEQUENCES DE GENES ET DE PROTEINES
J. C. Hervé, D. Lenne, J.F. Rodes, N. Salamé, B. Thérrîé
287
I - L'EVOLUTION DES CONNAISSANCES
289
A. Quelques repères historiques
B. Les connaissances de biologie moléculaire
dans les programmes des lycées
C. Conséquences pédagogiques
IL BANQUES D E DONNEES ET LOGICIELS DE TRAITEMENT
EN BIOLOGIE MOLECULAIRE
A. Les bases de données internationales
B. Les traitements des séquences
C. Les choix opérés dans les logiciels disponibles
III. ENSEIGNER LES CONNAISSANCES DE BASE
AVEC U N LOGICIEL D'ANALYSE DE SEQUENCES (SEQAIDII)
A. Fonctionnalités du logiciel
1. Lecture, écriture, visualisation de séquences
2. Edition et conversion de séquences
3. La comparaison (alignement) de séquences
4. Analyse de séquences
B. Banque de données associée à SEQAIDII
1. Constitution de la banque
2. Contenu de la banque
C. Les thèmes d'utilisations du logiciel et des données
1. Code génétique : caractéristiques, cadre de lecture
2. L'ARN messager
3. Activités autour du gène eucaryote
4. Allèles du gène, mutations et conséquences
5. Familles multigéniques et complexification du génome
D. Les utilisations en classe
IV. ETUDIER L'EVOLUTION A PARTIR
DE DONNEES MOLECULAIRES
A. Fonctionnalités du logiciel EVOLUTION MOLECULAIRE
1. Choix des espèces
2. Travail sur des séquences non alignées
3. Travail sur des séquences alignées
a. Calcul et affichage d'une matrice des distances
b. Calcul et affichage d'un arbre phylogénétique
c. Comparaison de deux matrices
B. Utilisations pédagogiques
1. Familiarisation avec la classification phylogénétique des vertébrés
2. Notions d'homologie, de mutation et de contrainte fonctionnelle
3. Réponses à un problème de parenté entre groupes
4. Rythme d'évolution des molécules chez les vertébrés
5. Réalisation de quelques phylogénies
6. Duplication de gènes
V. CONCLUSIONS ET PERSPECTIVES
289
291
292
294
294
296
297
298
298
299
301
303
306
307
307
308
310
311
312
315
315
316
319
328
329
331
332
332
333
333
334
334
336
336
337
338
339
341
342
Ce travail est infiniment redevable à Monsieur Jean-Claude Hervé, IPR-IA
de Biologie-Géologie de l'Académie de Versailles, pour sa participation
effective à la recherche.
Le chapitre consacré à la transmission de l'information dans l'organisme a
bénéficié de son analyse approfondie des logiciels de physiologie nerveuse qui
sont décrits. Il a veillé sur la rédaction de l'ensemble de ce chapitre et donné
forme à la démarche pédagogique proposée pour l'exploitation des outils.
Plusieurs des pages consacrées à l'énoncé des problèmes et à la manière de les
résoudre ont été rédigées par ses soins.
Le chapitre sur l'analyse de séquences de gènes et de protéines, dans sa
structuration et dans ses composantes scientifique et pédagogique, lui est
totalement du. En remontant systématiquement aux publications originales, il a
identifié les séquences nucléiques et protéiques et leurs caractéristiques,
contrôlé la fiabilité des données extraites des bases internationales, fourni
toutes les indications scientifiques pour la saisie des gènes mutants et leur
intégration dans la banque de séquences à visée pédagogique.
C'est à la faveur des stages de formation pour les enseignants qu'il a
organisés dans l'Académie de Versailles, en 1991 et en 1992, que les outils et
les démarches ont été patiemment testés et discutés avec les professeurs
stagiaires, avant d'être proposés pour expérimentation dans les salles de classe.
Introduction
N. Salamé
Dans cet ouvrage collectif, nous essayons de rendre compte des explorations
entreprises entre 1988 à 1992 concernant "la contribution de l'informatique au
renouvellement des activités expérimentales en biologie et en géologie". Cette
publication est destinée, en premier lieu, aux enseignants de cette discipline ;
elle a donc été écrite en privilégiant la description des instruments et des
démarches d'exploitation pratiques, donnant une grande place aux illustrations
et évitant, dans la mesure du possible, les détails techniques.
Nous nous limiterons, en introduction, à replacer le travail dans son
contexte, rappeler les lignes directrices et la méthode de déroulement qui
rendent compte de sa cohérence d'ensemble, résumer ses résultats globaux.
Cette recherche menée dans l'unité Informatique et Enseignement de l'INRP
s'inscrit dans le cadre d'une orientation où sont analysées les interactions entre
le développement des techniques d'investigation dans les domaines
scientifiques, d'un côté, et celui des contenus et méthodes d'enseignement de
l'autre. Ce ne sont donc ni des préoccupations purement technologiques, ni des
considérations exclusivement disciplinaires qui orientent les investigations dans
cette unité, mais plutôt les perspectives ouvertes par l'innovation technique
pour l'évolution pédagogique. Ainsi, les méthodes de conception des
instruments et des environnement d'apprentissage, les compétences requises ou
introduites par l'utilisation d'approches informatisées, les activités générées et
proposées aux élèves constituent des thèmes centraux.
En ce qui concerne la recherche qui nous intéresse ici, nous avons pris en
considération, d'abord, le fait que l'enseignement de la biologie et de la
géologie est confronté depuis des années à la nature des nouveaux savoirs
impliqués (explications biochimiques, mécanismes géophysiques, régulations
complexes, interactions systémiques, etc.). Cet enseignement continue,
cependant, de maintenir les objectifs d'une formation méthodologique
expérimentale des élèves. Le contact avec le réel, la manipulation physique des
objets, l'utilisation de l'instrumentation, la conception de protocoles
expérimentaux, etc. sont considérés comme des supports de la motivation des
élèves et des conditions pour l'acquisition de savoirs intellectuels et
opératoires. Or, ni les écosystèmes, ni les mécanismes cellulaires et
moléculaires, ni les grandes manifestations de la tectonique ne peuvent être mis
aisément et sans médiation à la portée des élèves.
C'est donc par référence à ces options pédagogiques que nous avons tenté
d'étudier dans quelle mesure des facilités ou des innovations peuvent être
apportées par les ordinateurs, pour pallier les problèmes posés dans
l'enseignement et l'apprentissage des nouvelles connaissances. Il convient de
noter que l'informatique a constamment joué ce rôle instrumental en sciences
expérimentales. Dans cette optique et avec des objectifs similaires aux nôtres,
diverses approches ont été impulsées ces dernières années (simulations,
traitement d'images numériques, expérimentation assistée par ordinateur, etc.)
et sont toujours l'objet d'investigations et de développements.
Malgré ces efforts, il nous semble que l'une des questions qui reste posée,
concerne le statut et la justification de l'utilisation de l'informatique qui est
perçue par beaucoup d'enseignants comme une technologie éducative
accessoire. L'idée maîtresse de la recherche que nous avons entreprise est
d'appuyer les utilisations des ordinateurs en biologie et en géologie sur leurs
utilisations scientifiques et professionnelles. Cette référence implique l'apport
d'exemples démonstratifs de l'efficacité des outils informatiques et de leur
caractère indispensable pour l'étude de domaines et de concepts qui sont
fondamentaux pour l'enseignement de ces disciplines.
L'extension de l'utilisation des ordinateurs dans la plupart des domaines
scientifiques des sciences de la Vie et de la Terre, l'évolution des méthodes de
conception des logiciels professionnels dans lesquels une importance plus
grande est dorénavant accordée aux qualités de l'interface utilisateur, ont
constitué des d'arguments confortant l'hypothèse de faisabilité de cette
recherche, et laissant a priori entrevoir que des exemples pertinents et
convaincants pouvaient être détectés. Des investigations préalables avaient
montré que les applications professionnelles faisaient fréquemment appel à des
méthodes et des techniques particulières (les banques de données, les
traitements mathématiques et statistiques, les visualisations graphiques), en vue
de la construction de modèles ou de l'aide à la décision. Ce sont les bénéfices
potentiels qui peuvent être tirés de ces approches que nous avons visés.
Pour déterminer les domaines précis d'investigation, nous avons essayé de
concilier leur intérêt pédagogique (leur appartenance aux programmes et le
caractère problématique de leur enseignement) et la probabilité d'y rencontrer
des applications informatiques évoluées et transférables à l'éducation. En
géologie, les explorations ont concerné la modélisation de la subduction ; en
l'hydrogéologie la gestion quantitative et qualitative des nappes d'eau. En
biologie, l'intérêt s'est focalisé sur l'amélioration de la production végétale
(fertilisation) et animale (nutrition), l'enseignement de la neurophysiologie, la
biologie moléculaire. L'attention a porté également sur les banques de données
épidémiologiques, dont plusieurs ont été collectées mais dont l'intégration
pédagogique n'est pas encore suffisamment clarifiée. En revanche, l'apport des
méthodes industrielles de suivi automatisé de milieux biologiques a fait l'objet
d'un travail qui n'était pas envisagé au lancement de cette recherche.
Dans tous ces domaines, nous avons appliqué une méthode d'exploration
identique, à savoir : une première étape de contacts avec les organismes
scientifiques ou professionnels pour avoir un aperçu des pratiques actuelles,
des problèmes traités et des utilisations en cours de l'informatique ;
l'identification de logiciels, de données, de ressources diverses pouvant donner
lieu à une activité d'investigation avec les élèves, l'acquisition de ces outils,
leur analyse et la réalisation de tests ponctuels sont intervenus dans un
deuxième temps ; nous avons enfin procédé à l'adaptation et à la construction
d'outils complémentaire, à la constitution des banques de données utiles pour
l'enseignement, à la définition de démarches d'exploitation en situation
expérimentale dans les classes.
Les résultats intermédiaires de ces investigations ont été présentés de
manière succinte au cours du colloque "l'informatique scientifique dans
l'enseignement de la biologie et de la géologie au lycée", organisé à l'INRP
conjointement avec l'Ecole Normale Supérieure, en juin 1991. Dans la
présente publication, les différents chapitres consacrés aux thèmes de travail,
dressent un bilan détaillé des étapes franchies. Les conclusions générales et
transversales que l'on peut en dégager sont les suivantes :
1 - l'existence de multiples instruments informatiques issus des usages
professionnels, et correspondant à des domaines où les activités réalisables par
les élèves se sont raréfiées, est confirmée. Pour certains thèmes qui font l'objet
de recherches en cours (géophysique, biologie moléculaire, neurophysiologie,
notamment), la plupart des logiciels élaborés par les chercheurs et des banques
de données identifiées sont du domaine public et donc aisément accessibles
pour l'éducation. En revanche, dans les domaines où ce sont les applications
qui dominent, les logiciels commercialisés (qui sont parfois la reprise de
logiciels de chercheurs) sont généralement assez coûteux et donc difficiles à
acquérir. Les logiciels identifiés permettent de traiter une famille de données
ou de situations. De manière générale, ils sont de bonne facture technique,
présentent de nombreuses fonctionnalités, dont une partie est à la portée des
élèves des lycées. Leur richesse et leur caractère général et "ouvert" font que
ces outils peuvent être exploités dans plusieurs cycles de l'enseignement
(lycées, classes préparatoires aux grandes écoles, enseignement supérieur), à
plusieurs niveaux d'approfondissement. En contrepartie de leur puissance il
convient de leur reconnaître une certaine complexité.
2 - Par définition, ces instruments ne sont pas conçus pour des usages
éducatifs. On ne peut donc pas, sans préparation, les confier à des élèves qui
suivraient un cheminement prédéterminé qui n'existe pas. Ces outils permettent
d'aller d'autant plus loin que l'utilisateur maîtrise la méthode d'approche et les
concepts de base. Il faut donc élaborer des stratégies d'introduction des
connaissances et des documents utilitaires qui vont faciliter ensuite la mise en
oeuvre d'un processus personnel d'investigation.
Cette mise en place, chez les élèves, de la maîtrise technique et des méthodes
d'exploration adaptées au domaine traité, nécessitent du temps. Le caractère
général des outils, l'extension des questions qu'ils permettent de traiter,
l'approfondissement qui en résulte, sont des facteurs importants pour évaluer
l'intérêt de leur appropriation par les élèves. Plusieurs des exemples fournis
montrent que ces outils peuvent servir dans plusieurs chapitres, et constituer
ainsi une armature pour les modules disciplinaires prévus dans la réforme
récente des programme.
3 - La nécessité d'une modification, voire d'une refonte totale de ces
logiciels est à discuter cas par cas. L'adaptation à l'enseignement qui pourrait
conduire à une simplification des approches entraînerait également une rupture
avec la notion d'outils professionnels. Or, cette dimension semble jouer un rôle
important dans les représentations que les élèves et les enseignants associent
aux activités proposées, et finalement dans l'investissement qu'ils consentent.
4 - La nature des activités générées par ces outils renouvelle, dans
l'ensemble, l'approches des problèmes dans les domaines concernés ainsi que le
type d'interrogations qu'on peut formuler et essayer d'instruire ou de tester. Si
l'on peut discuter de leur caractère "expérimental" au sens strict, il n'empêche
que ces activités ne se réduisent pas à des manipulations formelles, mais font
appel à la mise en oeuvre de savoirs biologiques et géologiques très précis. Les
quantifications qui accompagnent souvent les applications de l'informatique en
sciences, constituent une avancée importante dans certains domaines, et une
contribution au renforcement de la dimension scientifique de l'enseignement.
5 - 1 1 faut maintenant passer des produits prototypiques aux outils banalisés,
en assurant la disponibilité réelle des données et des logiciels pour leurs
destinataires. La question ne se pose pas pour les logiciels commerciaux, alors
que des solutions doivent être trouvées pour les produits construits ou adaptés
dans le cadre de cette recherche. Plusieurs modalités sont à mettre en oeuvre :
négociation avec des éditeurs privés (ceci est déjà fait dans le domaine de
l'évolution moléculaire), accord avec des éditeurs publics (une négociation est
en cours pour la diffusion du logiciel de traitement de séquences et des données
associées, et on envisage d'assurer de la même manière celle des logiciels de
géophysique) ; accord avec de grandes entreprises (convention en préparation
avec EDF pour la diffusion des logiciels d'écoulement d'eau), etc.
6 - 1 1 convient enfin d'évoquer les directions de travail qui sont ouvertes.
Des explorations similaires sont à conduire dans d'autres domaines où l'on
manque cruellement d'instruments d'investigation pour les élèves, qu'il s'agisse
des contenus classiques importants (neurochimie, régulations) de chapitres
introduits ou amplifiés dans les nouveaux programmes (la dynamique externe)
ou de domaines nouveaux (la géochimie). Il est indispensable, en outre,
d'entreprendre les recherches nécessaires pour une appréciation fine de
l'impact des nouveaux instruments auprès des enseignants et leurs conséquences
sur l'apprentissage des élèves.
T E N T A T I V E D E M O D E L I S A T I O N DE LA L I T H O S P H E R E
DANS L E S Z O N E S D E S U B D U C T I O N
R. Culos, S. Dupouy, C. Gros
Ce travail est particulièrement
redevable à :
- M. BAYER, Université des Sciences et Techniques du Languedoc,
Centre géologique et géophysique, Montpellier
- M. de CABISSOLE, Université des Sciences et Techniques du Languedoc, Centre
géologique et géophysique, Montpellier
- M. SARRAILH, Bureau Gravimétrique International, Toulouse
ainsi qu'à :
- M. DERAMONT, Université Paul Sabatier, Laboratoire de géophysique, Toulouse
- Mme GUERRERO, Université Paul Sabatier, Toulouse
- M. HAZTFELD, Université Joseph Fourier, Laboratoire de géophysique interne
et tectonophysique, Grenoble
- M. LALLEMANT, Ecole Normale Supérieure, Département de géologie, Paris
- M. MASCLE, Université Paris VI, Laboratoire de géodynamique sous-marine,
Villefranche-sur-Mer
- M. MERCIER, Université Paris XI, Laboratoire de géophysique, Orsay
- M. SOREL, Université Paris XI, Laboratoire de géophysique, Orsay
- Mme VELDE, Université Paris VI, Laboratoire de pétrologie minéralogique
T E N T A T I V E D E M O D E L I S A T I O N D E LA L I T H O S P H E R E
DANS LES ZONES DE SUBDUCTION
23
R. Culos, S. Dupouy, C. Gros
I. LES ORIENTATIONS PEDAGOGIQUES
A. Le contexte
B. Les approches antérieures
C. Les objectifs
II. LES LOGICIELS ET LES DONNEES DISPONIBLES
A. Les logiciels recensés
1. Logiciels commerciaux de visualisation graphique
2. Les logiciels de modélisation
B. Les données disponibles
1. Nature et origine des données recueillies :
2. Format, volume et préparation des données :
C. Les logiciels utilisés
1. SURFER : logiciel de traitement et de visualisation graphique
2. GRAMMAG : logiciel de modélisation graphique
3. COUPER : logiciel de réalisation de profils
4. POLYDES : logiciel de visualisation des séismes
5. MENUGEO : module intégrateur
m. LA DEMARCHE PEDAGOGIQUE
A.
B.
C.
D.
Présentation géographique
Bathymétrie
Mise en évidence d'une relation bathymétrie-gravimétrie
Recherche de données complémentaires
1. Données de sismique naturelle
2. Données de sismique réflexion-réfraction
E. Elaboration du modèle
1. Réalisation de l'ébauche sur papier
2. Transfert du modèle sur machine
F. Synthèse : le modèle dynamique
IV. DISCUSSION
A. Les données
B. Les logiciels
C. Le travail du professeur
D. Les réactions des élèves
E. Les contenus et les programmes
F. Les perspectives
24
24
25
27
28
28
28
29
30
30
32
34
35
39
43
44
45
48
48
49
52
54
54
57
59
59
59
61
63
63
63
66
66
68
69
T E N T A T I V E D E M O D E L I S A T I O N DE LA L I T H O S P H E R E
DANS L E S Z O N E S D E S U B D U C T I O N
En biologie et en géologie, l'expérimentation, le recueil de données et la
construction de modèles occupent une place très importante dans la recherche
comme dans l'enseignement. Les outils informatiques y contribuent de manière
différente suivant les domaines. Pour certains contenus actuellement enseignés,
les ordinateurs rendent possible, en classe, l'acquisition de données
expérimentales en temps réel pour mettre en évidence, par exemple, les
facteurs qui interviennent dans la photosynthèse, les conditions de transmission
du message nerveux, ou pour contrôler les facteurs physico-chimiques d'un
milieu. L'exploitation de ces données peut conduire à une meilleure
compréhension des phénomènes étudiés et à formulation de lois. Dans d'autres
domaines, cette acquisition directe de mesures par les élèves n'est pas possible,
soit à cause du facteur temps, les données pouvant être anciennes ou se
répartir sur une longue période, soit à cause du facteur espace, les données
pouvant provenir de sites géographiques éloignés, soit encore parce que les
mesures à réaliser nécessitent des matériels et des traitements correcteurs très
spécifiques. C'est généralement le cas en géophysique où il faut recourir aux
résultats déjà enregistrés par les chercheurs. Cependant, vu l'évolution des
équipements des lycées et collèges, les phases du traitement, de la visualisation
graphique et de la modélisation à partir de ces données sont tout à fait
possibles en classe, à condition d'opérer au préalable :
- une sélection raisonnable dans les données existantes, pour se limiter aux
mesures et aux calculs compréhensibles par les élèves,
- une préparation de ces données pour qu'elles soient aisément exploitables
par les logiciels courants disponibles,
- une mise au point de démarches pédagogiques montrant la faisabilité
d'approches pédagogiques cohérentes avec les contenus et les méthodes
actuelles de l'enseignement.
Dans ces conditions, les outils informatiques peuvent s'avérer des outils
précieux pour aborder, par exemple, les grands faits de la tectonique des
plaques à travers les données géophysiques et tenter de modéliser la
lithosphère. C'est ce que nous avons essayé de réaliser sur les zones de
subduction.
I. LES ORIENTATIONS PEDAGOGIQUES
A. Le contexte
Pendant de nombreuses années, la géologie fut descriptive. Les observations
disponibles étaient limitées aux parties les plus superficielles des continents, de
sorte que les géologues ne disposaient pas d'un ensemble cohérent de données
permettant une approche globale des phénomènes. Depuis la fin des années 60,
les sciences de la terre ont subi une profonde évolution avec la naissance de la
théorie de la tectonique des plaques ; théorie unificatrice permettant
d'expliquer les grands faits géologiques : orogenèses, volcanisme, séismes et
montrant l'étroitesse des liens unissant ces phénomènes.
Cette théorie a pris naissance après l'accumulation de nouvelles données
dues à de récentes technologies d'investigation de la croûte terrestre,
continentale et océanique. La géophysique et la géochimie ont été les moteurs
de cette théorie et les pourvoyeurs de données nouvelles, abondantes et
précises. Des navires et des submersibles ont été équipés d'appareils destinés à
cartographier les fonds océaniques, à observer directement la croûte océanique
jusqu'alors méconnue, à mesurer le paléomagnétisme des roches, à pratiquer
des forages sous-marins. La masse de données quantitatives ainsi collectées par
le géophysicien a pu être exploitée rapidement par le traitement informatique,
l'ordinateur permettant également des modélisations évolutives et des
simulations.
L'enseignement de la géologie dans les classes de lycées (premières
scientifiques et classes préparatoires) a suivi l'évolution des sciences de la
terre. Il est passé du stade descriptif au stade explicatif, de l'échelle locale à
l'échelle mondiale (D.
d)
Consacré à la dynamique du globe terrestre, l'enseignement de la géologie en classe de
première s'intéresse à la dynamique interne, au caractère historique des sciences de la terre et à
leur aptitude à développer l'esprit de synthèse, à mener aux abstractions. Cet enseignement
valorise le va-et-vient entre le réel complexe, les faits d'observation et l'expérience d'une part,
les modèles explicatifs d'autre part.
Les études proposées se situent d'emblée à l'échelle mondiale et prennent en compte le fait
que la compréhension de la dynamique du globe a associé, depuis 25 ans, le progrès en
géophysique avec les observations de terrain tour à tour origine des problèmes et sources de
données fondant puis confirmant les théories.
La priorité sera toujours accordée aux faits, et à partir de leur ensemble, l'élève devra
comprendre comment s'élaborent modèles et théories, comment un même ensemble de faits
peut suggérer plusieurs modèles, comment le pouvoir explicatif de la théorie en vigueur
engendre la découverte de nouveaux faits dont l'accrétion au modèle peut conduire à son
abandon, à l'élaboration de nouveaux modèles et au perfectionnement de la théorie.
Pour aborder les grands phénomènes de la dynamique du globe terrestre
l'enseignant est donc invité à un va-et-vient entre le "réel complexe", les
"modèles explicatifs" et "les théories" dont les élèves devront comprendre
l'élaboration".
Actuellement, pour atteindre ces objectifs, les documents disponibles sont le
plus souvent livresques, d'une qualité de reproduction parfois peu exploitable
et dont la technique de réalisation n'est pas toujours explicitée. De plus il est
difficile de se procurer tout un ensemble de documents cohérents et
complémentaires se rapportant à une même région. Les activités pédagogiques
sont de ce fait réduites à observer ou à interpréter des résultats expérimentaux
déjà traités, sans possibilité d'accès aux données de base et à la compréhension
des mécanismes de traitement et d'élaboration des documents et des modèles.
En particulier, la phase de conception des modèles échappe à l'initiative des
élèves qui sont peu sensibilisés aux paramètres importants pris en compte et à
l'incertitude du modèle résultant. Ils sont peu conscients que la modélisation
est une synthèse simplificatrice d'une réalité complexe. Etant donné par le
professeur (et non élaboré avec la classe), le modèle à valeur descriptive ou
explicative peut-être perçu comme une vision définitive, c'est-à-dire comme
l'explication du phénomène. Il n'est en fait qu'une représentation mentale d'un
phénomène non directement accessible à l'observation, mais élaboré à l'aide de
paramètres physiques et de données qui sont considérés comme étant la
conséquence du phénomène lui-même. De plus les élèves ne peuvent pas agir
sur le modèle et le faire évoluer à la lumière de nouvelles données.
B. Les approches antérieures
L'intérêt porté à l'utilisation pédagogique des banques de données
géologiques et de leur traitement informatique est déjà ancien. Parmi les
domaines explorés nous citons pour mémoire :
1. En 1978, l'étude du micro-thanétien de la Zone Sous-Pyrénéenne dans les
secteurs du Mas d'Azil et de Lavelanet (Ariège).
L'apport des techniques modernes, satellites et télédétection, explorations et forages sousmarins, sera particulièrement souligné et les outils pédagogiques qui en dérivent s'ajouteront
aux moyens traditionnels dont l'intérêt et la valeur demeurent. L'informatique apportera son
concours au fur et à mesure de l'édition des logiciels : banques de données sur les séismes et le
volcanisme, exécution de coupes et de blocs-diagrammes, simulation des mouvements de la
lithosphère, clés de détermination,
(supplément au B.O. n°21-2 juin 1988).
Les données correspondaient à des descriptions lithologiques et
paléontologiques provenant de l'examen de lames minces réalisées à partir
d'échantillons récoltés sur le terrain à travers deux profils. Le traitement
appliqué consistait en une analyse factorielle des correspondances.
L'interprétation des résultats faisait apparaître des associations biologiques
et leur relation avec le milieu conduisant à la réalisation d'un schéma de
reconstruction des biotopes du thanétien. La comparaison entre deux sites
mettait en évidence deux biotopes différents dans le bassin pyrénéen.
Dans cette étude, l'utilisation de l'informatique s'est limitée à la saisie d'un
fichier de données et au lancement d'un traitement mathématique complexe et
long mais le travail n'aurait pas pu être envisagé sans son concours.
2. En 1984, l'étude de la transformation des roches métamorphiques à l'aide
du logiciel T R A M E créé à cet effet. A partir de données concernant le massif
des Trois Seigneurs (Ariège), l'objectif était de retrouver les conditions de
pression et de température subies par les roches de ce massif.
Un premier module, à but didactique réalisait un apprentissage de
l'utilisation des diagrammes triangulaires et des données géologiques. Un
deuxième module donnait accès aux données de terrain, aux documents des
réactions chimiques expérimentales, aux diagrammes tétraédriques des
minéraux et des roches, aux graphiques de pression et de température, aux
courbes d'apparition et de disparition des minéraux afin que les élèves puissent
retrouver les conditions de formation des roches. Ecrit en LSE, le logiciel
fonctionnait sur PC à écran graphique monochrome. Elaboré pour fonctionner
de façon interactive, il laissait aux élèves une certaine autonomie de recherche.
3. En 1987, l'étude de la zone Nord-Pyrénéenne des Pyrénées centrales à
partir d'images satellitaires associées à des données géologiques : réseau
hydrographique, profils sismiques, données gravimétriques. Le traitement des
images était réalisé avec le logiciel TITUS. L'utilisation d'images satellitaires en
géologie implique des traitements spécifiques. La restitution en composition
colorée, suivant différentes combinaisons de canaux fournit une carte
géologique indirecte issue de la carte d'occupation des sols. L'application de
filtres directionnels permet d'extraire les linéaments. A la complexité de ces
traitements il faut ajouter que les modes d'impression disponibles dans
l'éducation ne sont pas suffisamment fins pour permettre l'analyse précise de
ces informations.
L'ensemble de ces travaux nous ont confortés dans l'intérêt d'une approche
des phénomènes géologiques à partir de données provenant des différents
domaines de la géologie et de la géophysique, et ont orienté les explorations
effectuées depuis trois ans.
C. Les objectifs
Nous nous sommes fixés pour principal objectif de mettre au point des
activités nouvelles permettant d'aborder les grands faits de la tectonique des
plaques, notamment la subduction, à l'aide des logiciels de représentation et de
modélisation utilisés dans les milieux professionnels ou dans la recherche, et
avec des banques de données multi-sources, notamment géophysiques
(gravimétriques, sismiques, volcaniques et bathymétrique).
En partant des données relatives à une même région, les élèves auront à
choisir les traitements et visualisations adaptés, en dégager des informations, y
associer d'autres informations apportées de façon plus conventionnelle
(documents papiers de cartes du Moho ou de profils de sismique réfractionréflexion), construire progressivement un modèle de structure lithosphérique
dans une zone de subduction.
Cette réalisation active du modèle suscite de nombreuses réflexions sur les
paramètres pertinents à prendre en compte, sur l'incertitude de certains
d'entre eux, sur certains autres qui seraient utiles mais non encore disponibles.
Le modèle peut alors être perçu par les élèves avec son vrai statut de
modèle, c'est-à-dire comme une représentation simplificatrice, ponctuelle,
fragile et non figée, d'une réalité complexe susceptible d'évolution à la lumière
de nouvelles données, et ne constitue donc pas une explication définitive du
phénomène ou de la structure étudiée. On peut ainsi faire percevoir que cette
représentation est constamment confrontée à la réalité, les nouveaux faits
observés permettant de conforter, de réfuter ou de modifier le modèle qui
n'est qu'une étape pour continuer l'exploration. Cette approche, qui fait
participer activement les élèves à la découverte d'un phénomène et à la
construction du modèle, met en oeuvre des qualités d'analyse, d'imagination,
de déduction logique, d'esprit critique et une habileté dans l'utilisation des
outils logiciels. Elle permet enfin de proposer des activités scientifiques
pratiques dans un domaine qui est parfois considéré comme très théorique et
dogmatique.
Nous avons d'abord envisagé de traiter des principaux concepts de la
tectonique des plaques en nous intéressant à une unité géographique, le
pourtour méditerranéen. Après avoir recensé les outils de représentation et de
modélisation accessibles, rencontré les chercheurs travaillant sur l'arc égéen,
cerné les données et réuni les documents scientifiques disponibles, nous avons
opté pour l'étude de la subduction de la plaque africaine sous la plaque
européenne dans ce secteur. Cette région, de par sa relative proximité
géographique, son intérêt touristique et culturel est familière pour beaucoup
d'élèves, et pouvait donc être plus motivante. Ce secteur illustre le concept
d'une subduction avec fosse, arc externe, arc interne volcanique, bassin
marginal en extension comparable à l'arc indonésien ou aux Petites Antilles.
II. L E S L O G I C I E L S E T L E S D O N N E E S D I S P O N I B L E S
La modélisation de la subduction pour une région donnée nécessite trois
types de données essentielles : bathymétriques et topographiques,
gravimétriques (l'anomalie à l'air libre), sismiques. Les données
géographiques permettent par ailleurs de bien localiser les faits observés.
Les outils informatiques recherchés doivent permettre la visualisation des
ces données sous forme de cartes (visualisation 2D) ou de blocs diagrammes
(3D), la réalisation de profils et la construction de modèles gravimétriques de
la lithosphère. Les logiciels à retenir doivent être adaptés à une approche
géologique, suffisamment conviviaux pour être mis entre les mains des élèves,
utilisables sur les PC équipant les laboratoires de biologie-géologie ou les
salles informatiques des lycées, et, enfin, d'un prix de revient en rapport avec
les possibilités financières des établissements scolaires.
A. Les logiciels recensés
1. Logiciels commerciaux de visualisation graphique
a. G D M (Gestion des Données Minières) édité par le B R G M . C'est un gros
logiciel modulaire professionnel. Parmi ses nombreuses fonctions, certaines
correspondent à nos préoccupations :
- les analyses de données,
- leur traitement statistique (histogrammes, corrélations, analyse en
composantes principales, visualisations graphiques associées),
- la digitalisation de cartes topographiques, gravimétriques, géoïde,
etc.,
- la possibilité de superposer deux types de cartes (topographique,
géologique, etc.),
- la réalisation de graphiques en 2 ou 3 dimensions,
- des simulations en fonction des données introduites.
Prix : 46
000F
pour le noyau
GDM
et
260 000F
pour la version complète.
b. U N I R A S . Ce logiciel modulaire est destiné à traiter plus particulièrement
des données gravimétriques et magnétiques. A partir d'une base de données, il
peut réaliser le profil des anomalies gravimétriques entre 2 points
géographiques. Il est alors possible de faire des modélisations en faisant varier
l'épaisseur et/ou la densité des couches jusqu'à ce que le profil théorique ainsi
obtenu coïncide avec le profil observé.
Ce logiciel fonctionne sur les PC, XT et AT. Il utilise la couleur ce qui rend
les modélisations en variations de densité très agréables. Les sorties sur
imprimante couleur sont possibles. Prix : 40 000 F environ.
c. DESCARTES MODELISATION. Il permet des représentations en cartes 2 D et
vues 3 D de toutes sortes de données faisant intervenir deux ou trois
paramètres. Il peut être utilisé en topographie, en géologie structurale, en
géophysique et en hydrologie (nappes aquifères).
De conception modulaire, seuls certains modules peuvent être acquis. Il
existe une version dite Junior, destinée à un plus grand public, moins
spécialisée que la version de base et ne possédant que les fonctionnalités
nécessaires à notre objectif.
Il est commercialisé par IGA (Informatique et Géophysique Appliquées).
Prix en version complète : 14500 F HT. Version Junior : 6950 F HT.
d. G R A P H E R . C'est un logiciel de statistiques permettant de traiter
n'importe quel type de données et pouvant représenter ces données, brutes, ou
traitées sous forme de profils ou de courbes en isovaleurs à 2 dimensions. Il
fonctionne sur micro-ordinateur. Prix 4000 F environ.
e. S U R F E R . Ce logiciel est implanté dans beaucoup de laboratoires de
recherche. Il permet de traiter un large éventail de données et fournit des
visualisations en deux et en trois dimensions. Nous avons retenu ce logiciel qui
tourne sur un PC parce qu'il présente de plus le meilleur rapport qualité-prix.
Nous reviendrons en détails sur ses fonctions. Son prix est, en 1992, de 3 5 0 0 F
HT pour l'éducation nationale.
S U F E R et G R A P H E R sont d'origine américaine et sont commercialisés par
Golden Software aux Etats Unis et par GEOCOM en France.
2. Les logiciels de modélisation
Ce sont généralement des outils écrits par les chercheurs ; ils sont adaptés au
traitement des diverses données gravimétriques, magnétiques, topographiques.
a. Le logiciel écrit par P . G E N T H O N chercheur au C N E S traite des données
gravimétriques avec simulations et modélisations gravimétriques de la
lithosphère, mais il ne possède pas d'environnement interactif agréable. Il ne
permet que l'impression en noir et blanc (pas de visualisation couleur sur
écran). Ecrit en F O R T R A N , il ne fonctionne que sur de gros systèmes. Son
transfert est difficilement envisageable sans modifications importantes.
b . Les logiciels écrits par les ingénieurs du Bureau Gravimétrique
International sont de deux types :
- des logiciels d'interprétation des anomalies gravimétriques et de
modélisation semblables dans leur conception au précédent,
- des logiciel de cartographie pour traiter des données bathymétriques,
topographiques, gravimétriques, tracer des courbes en isovaleurs, colorier les
zones d'égales valeurs, tracer un profil selon une direction donnée. Ils
tournent sur de gros ordinateurs et pourraient être transférés sur microordinateur.
c. G R A M M A G . C'est un logiciel conçu pour la modélisation à partir de
données gravimétriques et magnétiques. Mis à notre disposition par le
laboratoire de géophysique et tectonophysique de l'université de Montpellier,
ce logiciel sur PC possède des caractères de convivialité et un environnement
pédagogique correct. Nous le décrirons de façon détaillée.
B. Les données disponibles
1. Nature et origine des données recueillies
a. Les données bathymétriques de la région égéenne, sont obtenues par
numérisation de cartes aéronautiques dressées à partir de mesures ponctuelles
de l'US navy (N A V O C E A N ) . Elles ont été extraites du fichier ETOP05 délivré
par l'organisme américain National Geophysical Survey Data Center (NGSDC).
b. Les données gravimétriques sont recueillies ponctuellement, aussi bien en
mer que sur terre. Les valeurs utilisées ne correspondent pas à l'accélération
de la pesanteur mais à la différence entre cette valeur et la valeur théorique
que devrait avoir g, compte tenu de la latitude et de l'altitude de la mesure.
C'est donc l'anomalie à l'air libre qui est utilisée. Ces donnée proviennent d'un
fichier constitué à l'Institut Fur Erdmessung (Hanovre R F A ) . Les données
bathymétriques et gravimétriques nous ont été communiquées par le Bureau
Gravimétrique International de Toulouse.
c. Les événements sismiques sont enregistrés généralement à distance, par
des réseaux de stations. Nous avons limité les paramètres utilisés, aux
coordonnées du foyer, à la profondeur et à la magnitude de l'événement. Afin
de limiter la taille du fichier, les séismes de faible magnitude, les plus
nombreux mais pas les plus significatifs pour la subduction car ils sont surtout
superficiels, n'ont pas été retenus ; seuls les séismes de magnitude supérieure à
4,5 sur l'échelle de Richter figurent dans le fichier utilisé. Les données brutes
sont collectées par des organismes nationaux et internationaux qui les diffusent
après traitement. Les données sismiques mondiales sont éditées par l'US
Geological Survey sur CDROM.
Les données utilisées ne sont pas brutes : elles ont subi des traitements
correcteurs spécifiques à leur nature ou au type d'exploitation envisagé. Ainsi,
si l'objectif est de générer des cartes ou des vues en trois dimensions de la
bathymétrie, à l'aide de logiciels graphiques, il convient d'avoir des séries de
valeurs disposées aux noeuds d'une "grille" régulière.
Bien entendu, il est exclu d'adopter une telle contrainte lors de la collecte
des mesures qui sont tributaires des trajets des bateaux (fig. 1).
JUPON
gravimétriques
Fig. 1.- Trajets des bateaux lors des relevés des anomalies
permettant de constituer le fichier initial de données ponctuelles. Région du
Japon.
C'est un traitement spécifique qui permettra de calculer la grille régulière
en interpolant les valeurs ponctuelles mesurées. Les résultats dépendent de la
densité des mesures, du pas de la grille, de l'algorithme de recherche des
points, et surtout de la méthode mathématique appliquée. Ce calcul est parfois
très long et de toute manière il n'est fait qu'une fois en préalable à toutes les
exploitations : cartes, vues 3 D , et coupes. Ici, pour la topo-bathymétrie et la
gravimétrie, le BGI nous a fourni des données déjà interpolées au pas de 10
minutes.
Certains traitements enfin ne concernent que la présentation informatique
des nombres et l'aptitude des logiciels à produire ou à consommer des formats
particuliers, c'est le cas pour les séismes.
Les contours géographiques sont obtenus par numérisation de cartes. Il est
possible de réaliser soi-même ces fichiers contours ou de les acheter.
2. Format, volume et préparation des données
Les formats de fichiers doivent être adaptés aux particularités des logiciels
mais sont parfois différents d'un type de fichier à l'autre selon la nature ou
l'origine des données. Deux cas peuvent se présenter : soit les données sont
sous forme de grille régulière, soit ce sont des données ponctuelles.
a. Fichiers topo-gravimétriques et gravimétriques
Ces fichiers sont utilisés par SURFER pour les représentations en courbes
isovaleurs ou en blocs diagrammes. Ils doivent être constitués de grilles
régulières et ne contenir qu'une en-tête et les valeurs calculées aux noeuds de
la grille. Le logiciel reconstitue la localisation à partir de l'ordre des valeurs et
des informations de l'en-tête. Le premier nombre correspond à l'angle sudouest de la zone et les suivants se lisent d'ouest en est et du sud au nord. La
première ligne décrit ainsi le bord sud de la zone.
Exemple : Grille d'anomalies gravimétriques
* les commentaires situés après les * ne font pas partie du fichier.
* anomalies gravimétriques interpolées sur toute la carte (kriging).
DSAA
*
entête Surfer
73 43
*
nombre de colonnes, nombre de lignes
32 144
*
min X, max X (degrés)
31 38
*
min Y, max Y (degrés)
-8964.0 2390.0
*
min Z, max Z (mètres)
-1509.0 -1986.0 -2487.0 -2946.0 -4284.0 -4718.0 -4689.0 -4716.0 -4663.0 -4623.0
-4615.0 -4509.0 -4498.0 -4457.0 -4426.0 -4403.0 -4373.0 -4341.0 -4327.0 -4316.0
-4275.0 -4190.0 -4170.0 -4215.0 -4307.0 -4409.0 -4496.0 -4535.0 -4523.0 -4527.0
-4486.0 -4243.0 -4208.0 -4208.0 -4243.0 -4199.0 -3994.0 -3975.0 -3952.0 -3460.0
-2799.0 -2714.0 -1697.0 -1062.0 -1493.0 -1362.0 -1480.0 -1504.0 -1466.0 -1519.0
-1750.0 -1980.0 -2239.0 -2502.0 -2798.0 -2994.0 -3024.0 -3515.0 -4020.0 -4875.0
-5723.0 -7056.0 -8633.0 -7992.0 -7021.0 -6709.0 -6228.0 -5830.0 -5607.0 -5632.0
-5655.0 -5684.0 -5743.0
* FIN de la première ligne de la grille
Dans ce format ASCII les nombres (8 caractères) sont séparés par un espace ;
il y a 10 valeurs par ligne de texte, un retour chariot après la 73ème valeur
(une ligne de la grille occupant ici 8 lignes de texte).
Lorsque seules des données ponctuelles sont disponibles, celles-ci sont
regroupées dans un fichier texte (ASCII) où chaque ligne décrit un événement,
l'ordre des lignes étant indifférent .
Exemple : fichier d'anomalies gravimétriques
22,083
39.950
41.0
22,250
39.950
34.3
22,417
39.950
28.3
22,583
39.950
28.7
Sur chaque ligne : longitude, latitude et valeur de l'anomalie.
La conversion d'un fichier initial de données ponctuelles en grille régulière
à l'aide du module G R I D n'est à réaliser qu'une seule fois, les travaux
ultérieurs de représentation des données se feront à partir du fichier interpolé
régulier.
b. Fichiers sismiques
Le cas des données sismiques est un peu différent : seules les données
ponctuelles sont utilisées pour dresser des cartes ou des profils, il n'y a pas
d'interpolation des données. Le fichier SEISME nécessaire au travail envisagé
ne comporte que quelques paramètres. Chaque ligne contient longitude,
latitude, profondeur du foyer en kilomètres et magnitude. Ces paramètres sont
extraits de la base de données, sur support C D R O M , à l'aide des logiciels
d'accompagnement. Ne peuvent être retenus que les séismes qui répondent à
certains critères : zone géographique, magnitude, type d'événement, etc. mais
l'utilisateur ne maîtrise pas la liste des paramètres associés à chaque séisme. Le
fichier généré doit être à nouveau passé au crible afin de ne conserver que les
4 paramètres utiles. Cette reprise peut se faire sous D B A S E qui permet
d'extraire les 4 champs indispensables tout en éliminant les événements dont on
ne connaît pas la magnitude.
Exemple : fichier de séismes (données sélectionnées).
longitude
latitude
20,00
40.00
profondeur
magnitude
0.00
6.50
23,00
40.00
0.00
5.25
23,00
40.00
0.00
5.25
23,25
40.00
0.00
6.90
23,30
40.00
0.00
5.38
24,00
40.00
80.00
6.00
c. Fichier contours
SURFER admet ici aussi des données sous forme de texte où chaque contour
est décrit comme une suite de segments dont on connaît les coordonnées dans
le repère de la carte.
Exemple : fichier de contours
7 1401
* nombre de points du premier contour et identificateur de type de ligne.
30.29 31.24
* coordonnées du premier point
30.28 31.26
30.16 31.22
30.15 31.27
30.05 31.32
29.09 30.82
29.03 30.83
13 1401
* nombre de points du deuxième contour.
Le logiciel G R A M M A G exige un format particulier pour le "fichier
d'anomalies". Les colonnes 1 et 2 contiennent les coordonnées de chaque
station le long du profil (x, y), la colonne 3 contient l'altitude de chaque
station, la colonne 4 la valeur de l'anomalie et la colonne 5 l'erreur sur la
mesure de l'anomalie.
C. Les logiciels utilisés
Pour réaliser l'étude de la subduction à partir de l'ensemble des données
accessibles, nous avons utilisé les deux logiciels disponibles, S U R F E R et
G R A M M A G ; en outre, plusieurs outils complémentaires ont du être été écrits.
En effet, les différentes données fournies par le BGI ou extraites de CDROM ne
sont pas directement utilisables par les logiciels, il faut donc convertir les
fichiers initiaux en fichiers ayant un format lisible par les logiciels SURFER et
GRAMMAG.
D'autre part, l'exécution de taches spécifiques, indispensables, a conduit à la
conception du logiciel de réalisation de coupes, C O U P E R . De plus, aucun
logiciel n'a été trouvé se prêtant à la visualisation en 3 D des séismes, ce qui
nous a amenés à concevoir le logiciel P O L Y D E S . Enfin un menu intégrateur
permettant des accès rapides et conviviaux aux différents outils et fichiers s'est
avéré nécessaire.
1.
SURFER
: logiciel de traitement et de visualisation graphique
S U R F E R Access System Version 4.14
C o p y r i g h t (c) Golden Software Inc. 1989
(MAIN MENU)
1
1
1
T
T
TOPO SURF
GRID
VIEW
PLOT UTIL
r
±
Visualisation
du document
Interpolation et
calcul d'une
grille régulière
CARTES
BLOCS
DIAGRAMMES
QUIT
±
Calculs
annexes
Impression
Fig. 2.- Fonctions du menu principal de SURFER.
Surfer calcule et représente des séries de valeurs continues sous forme de
cartes ou de blocs diagrammes. Les représentations sont uniquement
vectorielles, "fil de fer" désormais classique, donnant des images fixes ne
tournant pas en temps réel. Il comporte plusieurs modules accessibles depuis
un module intégrateur ou, directement, si l'espace mémoire est insuffisant.
Chaque module donne accès à de nombreuses pages écran proposant des
modifications de paramètres de représentation et d'environnement graphique :
titres, textes etc. L'état du travail en cours peut-être visualisé à tout moment et
rapidement en activant la touche F2, ce qui permet de juger immédiatement de
l'effet de la modification apportée. Seuls les trois premiers modules, G R I D ,
TOPO et SURF sont nécessaires au travail envisagé.
a. Module GRID
Le module calcule (interpole) une grille régulière à partir de données
d'observation réparties irrégulièrement (X, Y, valeur). En entrée, les données
sont saisies au clavier ou lues dans un fichier ASCII. On peut choisir le nombre
de lignes, de colonnes, les valeurs mini ou maxi à prendre comme limites, la
méthode de calcul et les paramètres associés. En sortie, le fichier contient
uniquement les valeurs interpolées aux noeuds de la grille. Trois méthodes
d'interpolation sont proposées. Les calculs s'effectuent sur un rayon donné
autour de chaque point et prennent en compte un nombre maximum de points.
"INVERSE DISTANCE" : technique de moyennage pondéré, respecte les
sommets en accentuant les différences,
KRIGING" : technique géostatistique de calcul d'autocorrélation, respecte les
sommets et n'accentue pas les différences, c'est le mode de calcul que nous
avons retenu,
"MINIMUM CURVATURE"
KRIGING
h
0
KRIGING
n'accentue pas les reliefs, en lissant les données.
INVERSE
|
0
DISTANCE
INVERSE
DISTANCE
MINIMUM
l
0
CURVATURE
MINIMUM
CURVATURE
Fig. 3 . - Représentations obtenues en 2D et 3D après les trois traitements
possibles d'un même fichier initial par GRID.
b. Module TOPO
Ce module permet de visualiser sur écran ou d'imprimer à partir des
données de la grille, une carte d'isovaleurs. Les valeurs des courbes sont
spécifiées en donnant les valeurs minimum, maximum et l'intervalle entre
deux courbes. La fréquence des courbes maîtresses, avec étiquette, peut être
modifiée. De même, il est possible d'affecter des couleurs différentes à des
ensembles de courbes pour différencier des zones de valeurs. Un texte (titre,
légendes, échelle), un fichier de contours (côtes, rivières, villes), peuvent être
superposés.
[TOPO)
Input
t
Nom fichier
Sélection sous
image.
Level Scale Conline
Text Border XYLine Mesch Post
Echelle
carte
Texte bordures
et couleurs
Couleur des
courbes
Sélection minimum,
j
maximum,équidistance
document
des courbes de niveau
e
Fig. 4.- Fonctions du module
TOPO
x
t
e
s u r
Quadrillage
écran
Superposition
contour geographique
Output
Préparation
pour impression
Superposition
symboles sur
documents
de SURFER.
Fig. 5.- Carte de la bathymétrie de la région êgéenne réalisée par le module
de SURFER. Equidistance des courbes de niveau : 200 mètres.
TOPO
c. Module
SURF
Ce module produit des représentations 3 D à partir d'une grille. Il est
possible de choisir : le type de projection (orthogonale ou perspective), l'angle
de rotation par rapport à l'axe des X, et l'angle de visée.
Comme précédemment le choix des couleurs est possible ainsi que
l'adjonction d'un texte. Des fichiers de commandes, définissant un certain
nombre de paramètres fixes peuvent être créés à tout moment, à partir des
deux modules TOPO et SURF pour être réutilisés lors de travaux ultérieurs.
(SURF)
, n
P
u t
V
i
e
w
LineTyp
BaseText
Nom de fichier Choix des reSélection sous-| présentations
image.
Choix paramètres
de projection : angle
d'élévation, angle de
vue.
I
Axes Size XYLine Post Output Environ
Texte sur
document
Définition
dimention
image
Superposition
symboles sur
document
Coordonnées
Création
des axes Superposition
d'une base
contour géoau bloc
graphique
angle de vue
Choix couleur]
écran, taille
caractères...
etc..
Préparation
sortie impression pour PLOT
90°
1
1
e,o
/"~HXw *
—
f
d'élévation
0°
-|
1
i
270°
Fig. 6.- Fonctions du module SURF de SURFER et illustration du type de
projection possible.
d. Module
PLOT
C'est le module de transcription des fichiers créés par TOPO ou SURF en vue
d'une sortie sur n'importe quel périphérique, imprimante ou traceur. D'autres
modules permettent d'effectuer des calculs et de configurer les périphériques.
ARC
EGEEN
RHODES
Fig. 7.- Blocs diagrammes
de la topo-bathymétrie
et de
l'anomalie
gravimétrique
à l'air libre réalisés par le module SURF de SURFER et
superposés sur un même écran.Vue du sud-ouest sous un angle de 20° audessus de l'horizon.
2. GRAMMAG : logiciel de modélisation graphique
Le logiciel G R A M M A G a été conçu par Benoît de C A B I S S O L E à l'USTL de
Montpellier pour sa thèse sur la modélisation de la subduction de la plaque
lithosphérique ibérique sous la plaque européenne. Ce logiciel comporte deux
modules, un pour réaliser des modélisations gravimétriques, un autre pour les
modélisations magnétiques. Seul le premier module a été exploré et utilisé.
Conçu de façon interactive, GRAMMAG présente des fenêtres dans lesquelles
il convient de sélectionner l'action désirée. Deux grands types d'activités sont
envisageables, soit la création d'un nouveau modèle, soit la modification d'un
modèle existant. La modélisation est directe et en 2 dimensions.
Le logiciel calcule la réponse gravimétrique de formes polygonales et la
compare à la courbe des valeurs observées le long d'un profil (ou extraites
d'une grille lissée le long de ce profil).
a. Création d'un nouveau modèle
MODELISATION
MENU
PRINCIPAL
A DEUX
DIMENSIONS
Déplacez-vous avec les flèches Haut/Bas
ou avec la souris.
DEFINITION ENVIRONNEMENT
Validez par <ENTER> / bouton gauche
TYPE DE CALCUL
DEFINITION ANOMALIE
Annulez avec <Echap> bouton Droit
DEFINITION DE LA STRUCTURE
DEFINITION DES POLYG DEFINITION STRUCTURE
MODELISATION GRAPHl]
Par défaut
MISE A L'ECHELLE
par l'utilisateur
IMPRESSION
PARAMETRES STRUCTURE
FIN
Origine
Extension
Profondeur min
Profondeur max
Modèle de référence
Retour
Fig. 8 . - Logiciel GRAMMAG. Fenêtres du menu principal permettant
définir la structure de référence du modèle.
de
Après avoir choisi, à l'aide du menu principal, le fichier de l'anomalie
gravimétrique qui devra être modélisée, il faut définir la structure
lithosphérique de référence en précisant le nombre de couches pris en compte,
les épaisseurs et les densités. Le logiciel part en effet d'une structure en
couches régulières. L'option modélisation graphique permet de faire
apparaître les fenêtres graphiques : la fenêtre supérieur affiche la courbe de
l'anomalie gravimétrique observée et la courbe de l'anomalie gravimétrique
calculée par le modèle, qui sera horizontale et égale à zéro avant le début de la
modélisation : la fenêtre inférieure sert à l'élaboration du modèle. La
modélisation est réalisée par construction à l'écran, avec la souris, de
polygones dont le contraste de densité par rapport à la structure de référence
aura été préalablement indiqué. Le logiciel calcule ensuite la réponse
gravimétrique induite par le corps représenté. Les contrastes de densité sont
exprimés en g/cm ; l'anomalie gravimétrique en mgal.
3
Il est possible de modifier la forme et le contraste de densité d'un corps qui
est repéré par son numéro d'ordre de création. Le calcul de l'anomalie qui en
résulte permet rapidement de juger de l'effet de la modification. G R A M M A G
génère un fichier CORPS contenant la description des polygones construits qui
sera sauvegardé en fin de travail. Afin d'accélérer la modélisation, le logiciel
COUPER, qui génère la courbe de l'anomalie gravimétrique à partir du fichier
de la gravimétrie, prépare les polygones de l'eau à partir du fichier de la
bathymétrie. C'est donc sur une amorce de fichier CORPS où la réponse
gravimétrique en résultant est déjà calculée que va s'effectuer le travail de
modélisation. La création des "corps eau" permet un meilleur repérage
géographique sur l'écran, mais surtout évite des erreurs de modélisation. En
effet le contraste de densité entre l'eau (1,03) et la première couche
lithosphérique (2,7 en moyenne) est élevé ; la bathymétrie de ce fait influe
grandement sur l'anomalie gravimétrique.
b. Modification d'un modèle existant
Il suffit d'entrer directement dans l'option de modélisation graphique et
d'appeler le fichier modèle correspondant.
MENU
PRINCIPAL
Déplacez-vous avec les flèches Haut/Bas
ou avec la souris.
/ bouton gauche
DEFINITION ENVIRONNEMENT
TYPE DE CALCUL
MODELISATION
DEFINITION ANOMALI
Sans fichier modèle
DEFINITION DE LA STRU<
Lecture d'un fichier modèle
DEFINITION DES POLYG
MODELISATION GRAPHIQUE
F1 = AIDE
MISE A L'ECHELLE
IMPRESSION
FIN
pp> bouton Droit
MODIFICATION DU MODELE
Change les caractéristiques
Modification des polygones
Ajout de polygones
Suppression de polygones
Déplacements de polygones
Duplique les polygones
Rotation des polygones
Dilatation/Compression des polygones
Edition de polygones
Ajoute un fichier contours
Modifie les paramètres
SUITE
Fig. 9.- Logiciel GRAMMAG. Fenêtres permettant d'accéder aux options de
modification d'un modèle existant.
Fig. 10.- Modélisation d'une anomalie gravimétrique sans fichier modèle.
Fenêtre du haut : courbe de l'anomalie observée le long d'un profil et courbe
calculée, ici encore horizontale puisqu'aucun polygone n'est encore défini.
Fig. 11.- Le long du même profil figuration de la bathymétrie.
Les
polygones de l'eau ont été générés par COUPER. La courbe de l'anomalie
gravimétrique
calculée reflète la conséquence de la bathymétrie sur la
gravimétrie.
3.
COUPER
: logiciel de réalisation de profils
Ce programme qui travaille constamment en mode graphique réalise des
profils topographiques, gravimétriques, sismiques ou autres, à partir des
fichiers correspondants, et génère des fichiers directement utilisables par le
logiciel G R A M M A G . L'utilisateur peut visualiser la disposition du profil sur le
fond de carte, les points de mesure et les paramètres, afficher, imprimer ou
tracer les résultats. Il peut modifier les paramètres de calcul et la position du
trait de coupe au moyen de la souris et contrôler aussitôt les effets de ces
choix.
Nom du fichier
Fig. 12.- Fonctionnalités
Extrémité
Origine
X1
Y1
X2
Largeur de
Y2
du logiciel COUPER.
JAPON
0
a
'lOO^, '200
"300
'-100
BATHYMETRIE
"600 '600fiP'700 . ^
JAPON
SEISMES
-il33 AM d3§ i!3é à3? .138
Fig. 13.- Profils bathymétrique, gravimétrique
Japon. Logiciel COUPER.
.139
,H0
.Hl
.H2 d«qr<s Ej
et sismique dans la région du
4.
POLYDES
: logiciel de visualisation des séismes
P O L Y D E S projette sur l'écran un ensemble de points dont on connaît les
coordonnées dans l'espace. Une fois projeté, cet ensemble peut subir des
rotations en temps réel. La manipulation interactive rapide en trois dimensions
permet de rechercher visuellement la structure du nuage de points. Concernant
les séismes, la recherche visuelle permet d'orienter la recherche des meilleurs
emplacements pour effectuer un profil sismique. Le nombre des points (foyers
des séismes) affichés simultanément est modifiable en fonction d'une quatrième
valeur (magnitude) choisie interactivement
Le repère (3 axes) des rotations est choisi par l'utilisateur : repère lié au
nuage lui-même ou lié à l'écran. La couleur des points varie avec la distance à
l'observateur (8 couleurs sont utilisables). Le repérage est facilité par
l'affichage simultané d'un contour géographique.
Ce logiciel peut aussi animer des structures "fil de fer" ; il fonctionne
uniquement sur écran VGA couleur.
FICHIER
palette
Fig. 14.- Visualisation des hypocentres des séismes dans la région du Japon.
Vue de dessus donnant en fait la répartition géographique des épicentres et
montrant une très forte densité le long de la fosse du Japon.
e
I»
W
QUITTER
FICHIER
palette
Fig. 15.- Visualisation des hypocentres des séismes dans la région du Japon.
Vue du sud-est sous un angle de 20°au-dessus de l'horizon.
Les deux plans de Wadati-Benioff apparaissent clairement. A gauche celui
de la plaque des Philippines en subduction, caractérisé par un faible pendage, à
droite celui de la plaque Pacifique en subduction, caractérisé par son fort
pendage.
5. M E N U G E O : module intégrateur
Ce module organise l'accès à l'ensemble des programmes et des données. En
effet, du fait de leurs diverses origines, les logiciels utilisent et produisent de
nombreux fichiers qu'il faut gérer de façon fiable et transparente pour les
utilisateurs. Ce programme libère des problèmes syntaxiques et intègre
complètement la gestion des accès aux données et aux programmes. Les
principes organisateurs sont les suivants :
- permettre à tout utilisateur de lancer un traitement sans avoir à se
préoccuper de l'organisation du disque dur,
- protéger les données initiales et les programmes,
- faciliter l'accès à des répertoires prévus pour les utilisateurs, sur disque
dur ou sur disquette personnelle.
Le programme M E N U G E O actuel réalise une partie de ces fonctions tout en
libérant complètement l'espace mémoire pour les différentes applications. La
future version permettra également de fonctionner dans un environnement
réseau et d'accroître ainsi la fiabilité de l'ensemble.
AIDE
CATALOGUE
ANDES
\
QUITTER
1r
j
CONSTRUIRE BLOCS
REALISER PROFILS
MODELISER
DONNEES MAGMATIQUES
VISUALISER LES SEISMES
GEO.CMD topo/localisations géographiques
GRID.CMD
GRID initial
SURF.CMD
répertoire travail
surf initial
région
p
r
o
g
r
a
m
m
e
c
o
m
m
a
n
d
e
s
Fig. 16.- Menu intégrateur : l'utilisateur choisit une région, une activité, un
fichier de travail le programme assure le lancement du logiciel correspondant
et le retour à ce menu en fin d'activité.
DONNEES INITIALES POUR UNE REGION
Utilitaires :
mise au
format
s
SURFER (
w
Données
ponctuelles
BATHYMETRIQUE!
SURFER
SURFER
COUPER
GRAMMAG
REPRESENTATIONS DES
MODELES CALCULES
'ig. 17.- Schéma général de la chaîne de traitement de données.
III. LA DEMARCHE PEDAGOGIQUE
A l'aide de ces outils informatiques et de ces banques de données nous avons
défini une démarche pédagogique possible où alternent des parties de cours qui
permettent d'aborder les notions géophysiques utilisées, gravimétrie, sismique
expérimentale, mécanismes au foyer, et des activités pratiques en salle
informatique où les élèves vont créer leurs propres documents et tenter de
modéliser. L'expérimentation est précédée de l'étude de la structure du globe
et de la tectonique des plaques. Les élèves disposent d'une fiche pédagogique
d'utilisation des logiciels valable pour l'ensemble de la démarche et, pour
chaque TP, d'une fiche guide indiquant les différents sous-menus du logiciel à
utiliser et les consignes de travail pour l'activité du jour. Le travail s'effectue
par groupes de 2 à 3 élèves par machine.
A. Présentation géographique
Il s'agit d'une simple description des caractéristiques géographiques à partir
de la carte affichée à l'écran. La région étudiée est comprise entre 20° - 30° de
latitude E, et 31° - 40° de longitude N.Elle se situe entre la Libye au sud, la
Grèce à l'ouest, la Turquie à l'est. L'île de Crète sépare cette région en 2
parties, au nord la mer Egée jalonnée par un arc insulaire volcanique, les
Cyclades, présentant la forme d'un arc de cercle centré sur 38 5°N -26° E et
au sud la mer de Libye.
Fig. 18.- Carte géographique de la région égéenne. TOPO de SURFER.
B. Bathymétrie
Les caractéristiques bathymétriques vont être dégagées en utilisant les
logiciels SURFER et COUPER. Le module TOPO de SURFER sert à visualiser les
données sous forme de cartes (2D). Les élèves accèdent à différentes options
qui leur permettent de fixer :
- les altitudes ou les profondeurs minimum et maximum,
- les intervalles des courbes,
- les couleurs des courbes en fonction des profondeurs.
En faisant varier ces paramètres ils peuvent :
- afficher la carte de la bathymétrie et de la topographie,
- afficher la carte de la bathymétrie seule avec différentes
d'intervalles et 7 domaines de profondeur,
valeurs
- choisir des couleurs différentes pour les zones profondes et les zones peu
profondes ; faire apparaître les unes, les autres, ou les deux simultanément.
Fig. 19.- Représentation 2D de la bathymétrie de l'Arc Egéen par le module
situées
TOPO de SURFER. Zones comprises entre 0 et - 2500 mètres
essentiellement au nord de l'arc. La zone moins profonde en mer de Lybie
correspond à la ride méditerranéenne.
Fig. 20.- Représentation 2D de la bathymétrie de l'Arc Egéen par le module
TOPO de SURFER. Zones comprises entre - 2500 et - 5000 mètres situées
essentiellement au sud de l'arc.
Le module SURF de SURFER sert à réaliser des représentations en blocs
diagrammes (3D). L'option VIEW permet de fixer une direction géographique
de la vue en perspective, un niveau d'observation d'un observateur placé audessous du niveau 0, au niveau 0 ou au-dessus du niveau 0.
ARC EGEEN
TOPOGRAPHIE
Fig. 21.- Topographie-bathymétrie
de l'Arc Egéen en représentation
3D
grâce à SURF de SURFER pour un observateur situé au Nord-Est 20° au-dessus
de l'horizon.
Le Logiciel C O U P E R permet la réalisation de coupes selon différentes
directions. Les coordonnées des extrémités de la coupe s'affichent au bas de
l'écran, et la coupe est matérialisée par un trait sur la carte. Cette coupe
résulte de la projection des valeurs comprises dans une bande de part et d'autre
du trait de coupe. Plusieurs essais sont possibles.
Fig. 22.- Profil topographique-bathymétrique
réalisé par COUPER. Les
documents les plus représentatifs sont tirés sur imprimante ou table traçante et
constituent des documents originaux produits par chaque groupe de travail Ils
sont ensuite interprétés par écrit pour dégager les
caractéristiques
géographiques et bathymétriques.
L'examen des documents réalisés (cartes, blocs diagrammes et profils)
permet de déterminer deux domaines aux caractéristiques différentes et dont
l'arc insulaire est la limite :
- au sud de la Crète, un domaine profond, avec des fosses dépassant 3000m
de profondeur dessinant un angle de 110°, ce sont les Fosses Helléniques. Elles
comprennent à l'ouest, la fosse de Matapan dirigée N O - S E , et à l'est les fosses
de Pline et de Strabon dirigées O N O - E N E . Au sud de cet arc, un relief sousmarin de 500 à 1000m d'amplitude borde l'arc hellénique, c'est la ride
méditerranéenne.
- au nord de la Crète un domaine peu profond, le bassin Egéen qui se divise
en deux régions, séparées par les Cyclades :
- la mer Egée au nord, 500m de profondeur en moyenne, comprenant un
secteur septentrional constitué de fosses de -1500m de direction ENE-SSO,
- la mer de Crète au sud, plus profonde, -2500m en moyenne.
C - Mise en évidence d'une relation bathymétrie-gravimétrie
Les élèves en utilisant les mêmes fonctionnalités du sous menu L E V E L de
dans S U R F E R affichent les anomalies gravimétriques sous forme de
courbes en isovaleurs. Pour mieux distinguer les zones à anomalies négatives
et les zones à anomalies positives, ils peuvent choisir des couleurs différentes
de courbes, ou mieux ne faire apparaître qu'un seul type d'anomalie, négative
ou positive. La coupe gravimétrique associée à la coupe bathymétrique peut
être tirée sur le même document avec le fond géographique à l'aide du logiciel
C O U P E R . L'examen des documents gravimétriques fait apparaître deux
ensembles :
TOPO
- au nord de la Crète, des anomalies positives (bathymétrie faible) avec un
maximum au centre de la mer Egée,
- au sud, des anomalies négatives avec les valeurs les plus faibles (<= 200
mgal) constituant une ceinture au niveau des fosses. Le secteur de la ride
méditerranéenne présente des valeurs légèrement plus élevées (-100, -50mgal).
ARC EGEEN
GRAVIMETRIE
f o 6 e e de
LIBYE
CRETE
STRABON
Fig. 23.- Bloc diagramme des anomalies gravimétrique à l'air libre. Vue
qu'aurait un observateur placé au nord-est 20° au-dessus de l'horizon. SURF
du logiciel SURFER.
Fig. 25.- Carte des anomalies gravimétriques à l'air libre négatives de -300 à
0 mgal Ces anomalies négatives sont localisées au sud de l'arc insulaire, en
mer de Libye. Module TOPO du logiciel SURFER.
54
MODELlSATICN Cl4NS LES ZONES DE SI.JBCXJCTK)N - - - - - - - - - -
37
D
35
60
-0
-5
33
; - ,---"\~.
.
l
J
-~
l--... ~- -.---------=---------.--.--~- - - - - - - - - - - - - .-j
"\.
-100
~O
.....
----.....
-IO-O-~O"'---o-
,/
1=4~~ilC~-Qt...:~3ilQ ----!-IOO
_______ .........
.,"-' _,.'
ANOMALIE AIR LIBRE
,500
... ___ .-'r
__ a4:_~'___ :. .
I~
voo- &QQ.
o.
BATHYMETRIE
Fig. 26 .- Profils topo-bathymétrique et d'anomalie gravimétrique à l'air
libre réalisés le long d'une même direction et superposés. Logiciel COUPER.
La comparaison des documents topo-bathymétriques et gravimétriques met
en évidence une corrélation entre les représentations gravimétriques et
bathymétriques. Les zones profondes présentent une anomalie gravimétrique à
rair libre négative, les zones moins profondes présentent une anomalie
gravimétrique à l'air libre positive. Ces constats conduisent à rechercher des
hypothèses explicatives : les valeurs négatives observées au niveau des fosses
représentent un déficit important de masse ; les valeurs positives de la mer
Egée pourraient correspondre à une remontée mantellique dans une écorce
amincie.
D. Recherche de données complémentaires
1. Données de sismique naturelle
Deux activités sont proposées aux élèves afin qulils définissent les
caractéristiques de répartition spatiale des séismes : l'analyse des cartes de
distribution géographique des épicentres et des hypocentres des séismes.
Plusieurs cartes de répartition des épicentres peuvent être examinées. D'une
part, l'ensemble des épicentres avec quatre symboles et couleurs différents
utilisés en fonction de la profondeur des hypocentres. D'autre part, quatre
cartes représentant la répartition géographique des épicentres par domaines de
profondeur des hypocentres : séismes superficiels, moyennement profonds,
profonds et très profonds.
Fig. 27.- Carte de répartition des épicentres des séismes de magnitude
supérieure à 4,5. Les symboles indiquent le domaine de profondeur
de
l'hypocentre. Réalisée avec TOPO de SURFER.
Fig. 28.- Carte de répartition des épicentres des séismes de magnitude
supérieure à 4,5 du domaine de profondeur des hypocentres 10-40
Km.
Réalisée avec TOPO de SURFER.
L'analyse des cartes de répartition géographique des hypocentres des
séismes met en évidence une répartition non aléatoire : les séismes superficiels
dessinent 2 ensembles : au nord de la mer Egée, un ensemble de séismes lié au
système de failles anatoliennes, et, au voisinage des fosses, les séismes
superficiels localisés dans la partie convexe de l'arc entre les fosses et la Crête,
ce nouveau noeud se prolongeant plus ou moins dispersé sous la ride
méditerranéenne. Les hypocentres les plus profonds sont situés à l'aplomb de
l'arc volcanique externe, coïncidant avec la profondeur de 150km. Ces cartes
ne font apparaître que des domaines de répartition des hypocentres. La mise en
corrélation des trois types d'informations se fait le long de profils superposés
réalisés avec COUPER. Le profil sismique met en évidence l'existence d'un
plan de répartition des hypocentres, le plan Wadati-Benioff, prenant naissance
au niveau des fosses et plongeant de 30° en moyenne vers le nord.
%
\
L—?ARC
_
0
i
. \ . ;'
"^Z.
; :
v
\
50
-100
/
EGEEN
lV--"^-,.y
'• 0
jlÛii
,2UU
io
'o
'200
ANOMALIE
,JUU
,-tUU
,5100
,éU0
AIR LIBRE
,700
,800
-\
-3
-4
?
o
-30
'
B
rrjn&JO
I
A
n
T
11
•§Çi^h à
-60_
-90
0
H
Y
y
u
^m
^ u u
•
M
'600
E
'700
T
R
s
'oo
I
E
Krfl
'
0
•
-I20_
-150
\
Kl
,2
5
,23
• •
,24
,25
,26
,27 ~~"
SEISMES
d^gre^C.
Fig. 29.- Profils superposés
de la topo-bathymétrie,
de l'anomalie
gravimétrique à l'air libre, et de la répartition des hypocentres des séismes. La
taille du symbole est proportionnelle au nombre de séismes recensés. Logiciel
COUPER.
2. Données de sismique réflexion-réfraction
La connaissance de ces paramètres est indispensable à la phase ultérieure de
modélisation. Ils seront dégagés de l'étude de documents proposés de façon
plus conventionnelle. La carte du Moho permet de déterminer la limite croûtemanteau supérieur. L'épaisseur des couches de la croûte est déduite de
documents de sismique réflexion, la densité de ces mêmes couches peut-être
calculée à partir des vitesses des ondes P à l'aide des courbes de N A F E et
DRAKE.
Fig. 30.- Carte de la profondeur du Moho, limite de la croûte et du manteau
supérieur dans la région égéenne. J. MAKRIS1977.
CRETE - PARTHENION
M
Fig. 31.- Document de sismique-réfraction réalisé le long d'un profil sudnord à partir de Parthénion en Crète. Son interprétation donne l'épaisseur des
couches et la vitesse des ondes P. J. MAKRIS1977.
Fig. 32.- Courbes de NAFE et DRAKE permettant de déduire la densité des
couches lithosphériques en fonction de la vitesse des ondes sismiques P.
E. Elaboration du modèle
L'élaboration du modèle se fera en deux étapes : une préparation sur papier
du modèle lithosphérique, puis son transfert sur machine avec le logiciel
G R A M M A G qui calculera l'anomalie à l'air libre en résultant et la comparera à
l'anomalie gravimétrique à l'air libre observée. Il s'agira donc de tester la
validité du modèle proposé par rapport à sa réponse gravimétrique.
1. Réalisation de l'ébauche sur papier
Elle s'effectue sur une copie écran de la fenêtre de modélisation et sur une
faible profondeur, 50 Km environ, ce qui facilite la mise en place des
différentes couches et réduit les risques d'erreurs. Les différents paramètres
dégagés des analyses des différents documents créés ou consultés sont pris en
compte pour caler le modèle : inclinaison du plan Wadati-Benioff, épaisseur de
la croûte lithosphérique donnée par la carte du Moho, épaisseurs et densités
des différentes couches.
0
80
160
240
320
400
480
560
640
720
Fig. 33.- Ebauche papier de la modélisation. Travail d'élève.
2. Transfert du modèle sur machine
Les élèves, définissent la structure et choisissent le modèle de référence.
L'écran propose un cadre de modélisation dans la partie inférieure et présente
la courbe des anomalies gravimétriques correspondant à la direction de
modélisation choisie par les approches précédentes. Afin de faciliter la
modélisation les élèves appellent un fichier modèle qui propose une
modélisation sur une faible profondeur, environ 50 km, intégrant déjà la
bathymétrie selon la direction choisie. Les polygones de l'eau sont donc déjà
représentés (cf. fig. 10).
Au-dessus de la fenêtre de modélisation apparaissent en jaune la courbe des
anomalies gravimétriques à l'air libre et en rouge la courbe de l'anomalie
gravimétrique calculée correspondant au modèle construit. L'élaboration du
modèle va être poursuivie en dessinant, avec la souris, des polygones auxquels
sont affectés des contrastes de densité par rapport à la structure de référence.
Chaque ajout, modification de forme, de contraste de densité d'un polygone ou
d'un ensemble de polygones, etc., entraîne un nouveau calcul de l'anomalie et
modifie l'allure de la courbe calculée. Le modèle peut-être sauvé en cours de
construction et être repris plus tard. Un changement d'échelle de profondeur
de 50 à 150 Km est nécessaire pour représenter l'ensemble de la structure.
Au niveau de la mer de Crète, la remontée du manteau est liée à un
étirement crustal. La ride méditerranéenne correspond à une accumulation de
sédiments qui provoque un affaissement de la croûte.
0
80
160
240
320
400
480
560
640
Fig. 34.- Modèle gravimétrique de la lithosphère en subduction dans la
région égéenne en cours d'élaboration. Logiciel GRAMMAG. Travail d'élève.
720
80
IfoO
240
3ZO
400
*SO
SfcO
Fig. 35.- Modèle gravimétrique de la lithosphère en subduction
région égéenne. Logiciel de modélisation GRAMMAG.
«>40
dans la
F. Synthèse : le modèle dynamique
La compréhension des mécanismes tectoniques responsables des mouvements
de plaques requiert l'analyse des directions et de l'intensité des contraintes
déduites de l'étude des mécanismes au foyer. La carte des mécanismes au foyer
autour de l'arc égéen fait ressortir une zone de compression de direction SONE au niveau de la fosse de Matapan, une zone de décrochement dans le
secteur de la fosse de Pline et une zone de distension dans la mer Egée. Les
profils de sismique réflexion confirment :
- en mer Egée, un mécanisme d'expansion illustré par l'existence de failles
normales,
- en mer de Libye, un phénomène de compression responsable, entre autres,
de l'empilement sédimentaire observé au niveau de la ride méditerranéenne.
k«
La synthèse incluant la zone étudiée fait ressortir la dynamique de la région
qui est liée :
- au mouvement de l'Afrique vers le nord. Il apparait par l'étude des
mécanismes au foyer que la partie Ouest de l'arc subit des contraintes
entraînant la subduction, alors que la partie Est subit un mouvement
transformant senestre. On en déduit que le déplacement relatif de la plaque
Africaine par rapport à l'arc Egéen est un mouvement de rotation dont le pôle
se situe au NO. La subduction actuelle est due au plongement "spontané" de la
lithosphère en raison de sa densité supérieure à celle du manteau.
- A l'extension de la mer Egée avec amincissement crustal sans formation de
croûte océanique. L'interprétation géodynamique relie le mécanisme de
l'extension, provoquée par un écoulement de l'Egée vers la plaque Afrique à la
subduction de cette dernière.
- Au mouvement de la plaque turque vers l'ouest, qui comprime le bassin
Egéen vers l'est et favorise l'extension vers le sud.
Fig. 36.- Carte très simplifiée des mécanismes au foyer. Pour chaque région
n 'ont été retenus que les mécanismes au foyers les plus fréquents donc les plus
représentatifs.
IV. DISCUSSION
Une partie seulement des logiciels utilisés ont été conçus avec des
fonctionnalités correspondant strictement au travail envisagé. Pour une large
part, cet essai de modélisation a été réalisé à partir des données disponibles sur
divers supports avec des formats variables, et avec les logiciels S U R F E R et
G R A M M A G qui sont de conception plus ancienne. Ces outils ne sont pas
parfaits.
A. Les données
Il est toujours fastidieux de devoir transformer des formats de fichiers afin
de les rendre acceptables par un logiciel. Le format ASCII x, y, z de données
ponctuelles semble faire l'unanimité : SURFER accepte jusqu'à 5 colonnes de
nombres réels, COUPER et GRAMMAG utilisent des fichiers similaires.
Des données sismiques étant disponibles sur CDROM pour un prix modéré, il
devient possible à des établissements d'acquérir ces données sans passer par un
intermédiaire. Rappelons cependant que deux C D R O M , du même éditeur,
peuvent générer des données à des formats différents et pas très commodes à
utiliser avec nos outils. Il n'existe pas d'outils universels de conversion de
formats, les programmes correspondants devront donc être réalisés par les
utilisateurs. Le travail de mise en forme des données de base n'est réalisé
qu'une seule fois, mais il est possible à chaque enseignant de saisir et de traiter
ses propres sources de données.
B. Les logiciels
A l'exception de GRAMMAG, ces logiciels ne sont pas spécifiques et peuvent
être utilisés sur d'autres thèmes : représentation et évolution de nappes
aquifères au cours du temps, profils divers. Les élèves se sont vite familiarisés
avec les différents outils. S U R F E R et C O U P E R ont été utilisés au cours de
plusieurs séances de TP. Cette réutilisation des mêmes outils permet un travail
beaucoup plus rapide et autonome après la première séance où se fait
l'apprentissage. Comme déjà indiqué, chaque groupe est ensuite muni d'une
fiche précisant pour chaque TP, quelle fonctionnalité du logiciel il convient
d'utiliser et quels paramètres il est possible de faire varier. Il n'en reste pas
moins que la syntaxe anglo-saxonne de SURFER peut rebuter ou égarer certains
enseignants ou élèves, sans parler du coût du logiciel. Conçu par un chercheur
pour son usage personnel, G R A M M A G affiche des messages qui ne sont pas
toujours explicites pour un autre utilisateur.
1. SURFER
Le logiciel propose des pages écran pour chaque type d'action à effectuer
avec les différents modules, ce qui en simplifie l'usage. Seuls deux modules
sont utilisés avec les élèves, TOPO permettant des visualisations cartographiques
en 2D et SURF des blocs diagrammes en 3D.
Afin d'accélérer un peu le travail il a été proposé aux élèves, non des
fichiers bruts mais des fichiers en partie paramétrés avec les couleurs des
courbes de niveau, les labels, les équidistances, le cadre de la carte. L'activité
des élèves est guidée vers la modification des paramètres essentiels pour mettre
en évidence les caractéristiques géographiques ou géophysiques de la région
étudiée. Ainsi leur initiative est assez large pour la représentation des données
bathymétriques et gravimétriques. En revanche, ils n'auront pas accès aux
paramètres de modification de la visualisation des séismes, la construction de
ces cartes étant beaucoup plus complexe.
Une fiche préparée par le professeur doit guider l'élève vers les différentes
fonctionnalités à utiliser et lui indiquer les paramètres à faire varier pour
analyser les caractéristiques de la région. Pour certains élèves, le fait que ce
logiciel soit en anglais semble avoir été un élément de motivation.
2. COUPER
Ce logiciel qui permet de réaliser des coupes de manière interactive,
présente un nombre limité de fonctions. Son utilisation est donc très simple ;
écrit pour cette recherche, il s'avère bien adapté à la démarche pédagogique.
3. POLYDES
Le logiciel est d'ergonomie récente et assez facile à utiliser. Il ne permet
qu'une approche visuelle et qualitative du phénomène. La réalisation de
documents précis, pour déterminer l'angle du plan de subduction, doit être
effectuée avec COUPER.
4. GRAMMAG
a. Principe de fonctionnement
G R A M M A G permet la construction de modèles en contrastes de densité par
rapport à un modèle de référence de structure lithosphérique supposée
homogène et en plusieurs couches. Il est impératif de choisir un modèle de
référence le plus proche possible de la structure étudiée. Si celui-ci s'écarte
trop de la réalité, la courbe calculée des anomalies subit une translation
verticale : elle ne coïncide pas avec la courbe des anomalies mesurée, elle lui
est seulement parallèle.
Pour une approche de modélisation avec les élèves, une structure de
référence en deux couches s'avère suffisante. Les deux couches retenues sont la
croûte et le manteau supérieur soit, en domaine océanique, les densités
moyennes de 2,8 pour la croûte et 3,3 pour le manteau. Ce modèle de
référence préalablement défini par le professeur est proposé aux élèves. En
domaine continental, il faut reconsidérer le modèle de référence, en épaisseurs
et densités. Dans sa version actuelle, ce logiciel présente donc plusieurs
inconvénients :
- les couches du modèle de référence sont horizontales. Quand une même
couche géologique est à cheval sur deux couches de ce modèle il faut dessiner
indépendamment deux polygones, un dans chaque couche de référence, avec
des contrastes de densité différents, et ils apparaîtront avec des couleurs
différentes. L'aspect général du modèle achevé n'est pas tout à fait satisfaisant
parce qu'une même couche géologique, n'aura pas la même couleur sur toute
son épaisseur.
- Si le nombre de sommets d'un polygone est trop élevé il y a sortie de
l'application pour une raison que nous n'avons pas pu élucider. Ceci fait
perdre le travail en cours, c'est-à-dire parfois beaucoup de temps. Il est
impératif de sauver régulièrement le modèle pour n'avoir à reprendre,
éventuellement, que la dernière partie du travail.
Une nouvelle version de G R A M M A G est actuellement en cours d'installation
sous U N I X à l'USTL de Montpellier.
b. Le modèle et la modélisation
Le modèle est d'abord préparé sur papier. Cette étape est essentielle car le
modèle explicatif élaboré par les élèves doit jouer le rôle d'intégrateur et de
simplificateur des connaissances qui ont été successivement dégagées de
l'analyse des documents au cours des différentes séances de travaux pratiques.
Les élèves doivent réaliser que le modèle explicatif de structure lithosphérique
n'est pas une création sans fondements, mais une construction calée par des
données de sismiques naturelle, le plan de Wadati-Benioff, ou de sismique
réflexion-réfraction donnant la profondeur du Moho, l'épaisseur des couches,
les vitesses de propagation des ondes dont on déduit les densités. Ce n'est que
dans un deuxième temps que les élèves vont essayer de valider leur modèle sur
machine à l'aide du logiciel, en définissant interactivement les sommets des
polygones qui modélisent une partie de la structure lithosphérique. Le logiciel
permet aux élèves de tester une hypothèse de structure lithosphérique : la
courbe des anomalies gravimétriques qui résulte de la structure proposée est
comparée à la courbe des anomalies réellement observées.
Grâce à ce calcul immédiat les élèves prennent conscience de la validité de
leur modèle et peuvent le faire évoluer en modifiant la forme ou les densités
des polygones. L'enseignant n'est plus le simple juge du modèle achevé, il
accompagne sa réalisation par les élèves.
Les élèves sont arrivés très souvent à des résultats qui se rapprochent plus
ou moins des valeurs mesurées. Ce qui importe, pour nous, c'est la démarche
aboutissant au modèle bien plus que le résultat lui-même. La correction du
modèle vise à ajuster au mieux anomalies calculées et mesurées tout en ne
s'écartant pas des données qui contraignent obligatoirement le modèle. Les
élèves conviennent aisément qu'il faut rester vigilant pour éviter d'aboutir à
des structures fantaisistes ce qui ne saurait manquer de se produire si le
modèle n'était pas fondé sur des données géophysiques variées et précises.
Cette étape est donc particulièrement importante et délicate.
Techniquement, la modélisation peut être rapide si les machines sont
équipées de co-processeurs arithmétiques qui sont également très utiles pour
accélérer l'élaboration et l'affichage des cartes et des blocs diagrammes. Il est
souhaitable que l'équipement soit homogène : si une des machines n'a pas de
co-processeur, le travail y est retardé par rapport aux autres groupes.
C. Le travail du professeur
Sur le plan matériel, la préparation des TP nécessite un travail sur machine
pour élaborer des documents qui seront éventuellement distribués aux élèves
afin d'accélérer certaines étapes de la démarche ou pour suppléer à toute
erreur de manipulation qui ferait perdre le travail en cours, ce qui est
exceptionnel.
Le tirage sur imprimante des documents réalisés par chaque groupe d'élèves
n'est pas toujours réalisable dans la même séance de TP, surtout si le nombre
d'imprimantes disponibles est faible, ce qui est souvent le cas. Ce travail
purement matériel incombe actuellement au professeur (la possession d'un
micro-ordinateur personnel facilite particulièrement les choses). La version
réseau pourrait réduire ce temps : chaque groupe d'élèves lance son
impression sur l'imprimante unique mais performante, et le logiciel gère la
file d'attente.
D. Les réactions des élèves
Lors de l'application de cette démarche, les élèves nous ont paru apprécier
l'autonomie et les initiatives qui leur sont laissées pour créer leurs documents
de travail avant de les interpréter.
En effet, le travail sur ordinateur permet d'échapper à l'uniformité des
documents produits, notamment par la création de cartes diverses, de blocs
diagrammes dont les angles de vues peuvent varier d'un groupe à l'autre, ou
encore par l'exploration de profils tracés dans différentes directions. Les
résultats obtenus entraînent une réflexion sur la pertinence des choix effectués,
et alimentent des discussions argumentées entre les membres d'un groupe et
entre groupes. L'emploi de l'informatique contribue à donner aux notions
abstraites un caractère tangible et réel, grâce aux représentations sous forme
de cartes, de blocs diagrammes, de profils, et donc pour faciliter l'acquisition
de concepts nouveaux.
Dans la phase de recherche nous avons essayé d'explorer toutes les activités
possibles avec toute la variété des données en laissant une grande autonomie
aux élèves pour l'exploitation des données et l'élaboration individuelle des
modèles. De ce fait, l'expérimentation a dépassé le cadre horaire actuel des
programmes et a abordé de façon plus approfondie que de coutume les notions
géophysiques nécessaires pour traiter du phénomène de subduction.
TP.
COURS.
L'échographie sismique du globe.
La naissance d'une théorie.
Présentation de la région :
Géographie, Bathymétrie.
Les apports de la gravimétrie.
La gravimétrie.
Apports des données sismiques :
élaboration
d'un
modèle
structural.
Les
roches
magmatiques
volcaniques.
Apports des données magmatiques.
Calage du modèle.
Prise en main du logiciel
Méthodes d'étude de la croûte
:
la
sismique
terrestre
expérimentale.
Notions de pétrologie.
Le magmatisme.
GRAMMAG.
Validation du modèle.
Les mécanismes au foyer.
Le modèle dynamique.
Histoire géologique de la région.
Fig. 37.- Progression adoptée pour
l'expérimentation.
Dans une perspective de généralisation il est possible de gagner du temps :
- en regroupant les aspects bathymétriques-gravimétriques-sismiques en une
seule séance, chaque groupe étudiant et créant les documents d'un seul de ces
domaines, avec ensuite une phase de synthèse et de mise en commun des
résultats,
- en supprimant la partie cinématique à partir de l'étude des mécanismes au
foyer permettant de définir le sens des contraintes. Cette étude ne paraît pas
indispensable à la compréhension du phénomène de subduction et elle présente
un niveau de difficulté plus élevé ; son amputation ne compromet pas la
cohérence de ce qui précède.
E. Les contenus et les programmes
Les notions géophysiques indispensables, gravimétriques et sismiques en
particulier n'ont posé aucune difficulté particulière de compréhension. Le
niveau de connaissance n'excède pas le niveau moyen que l'on peut attendre
d'un élève de première S. Les lois de l'optique qui sont celles qui régissent, en
première approximation, la propagation des ondes sismiques sont au
programme de cette classe. Les notions de sismique réflexion et réfraction
seront d'autant plus faciles à maîtriser que le professeur de Sciences Physiques
aura préalablement traité cette partie de programme, ce qui est possible après
concertation. La gravimétrie n'est malheureusement enseignée en physique
qu'en classe de terminale. L'enseignant de géologie est donc contraint d'y
consacrer une partie de son temps. Les notions relatives aux mécanismes au
foyer sont difficiles à maîtriser par les élèves. Elles ont été traitées dans un but
dynamique, pour déterminer les directions des contraintes et faire une
interprétation cinématique du modèle.
Dans le nouveau projet de programme, commun à tous les élèves, la part
attribuée à la subduction n'excède pas une semaine et les remarques
précédentes restent valables. Il est prévu par ailleurs un enseignement
modulaire en classe de première scientifique devant permettre de "développer
des activités plus autonomes". Mais c'est surtout l'introduction d'un
enseignement optionnel, à raison de deux heures de TP hebdomadaires qui
fournirait un cadre horaire mieux adapté à la démarche et aux activités
proposées. Les orientations pédagogiques que nous avons adoptées
correspondent bien aux objectifs définis par la Commission Nationale des
Programmes dans le document "Orientations, présentation des programmes,
classe de première, biologie-géologie" du 30 Mars 1992, à savoir "privilégier
l'activité personnelle et l'initiative des élèves", "le travail en équipes", "la
conception et la mise en oeuvre de projets impliquant une recherche
personnelle".
En outre, ce thème de géophysique se prête bien à un travail interdisciplinaire avec l'enseignant de Sciences-Physiques en particulier.
Pour renouveler l'enseignement de la géologie, nous avons essayé de nous
référer aux méthodes informatiques pratiquées dans la recherche. Ceci nous a
amenés à aborder des domaines spécialisés des connaissances récentes. Si "la
science qui s'enseigne" dans les lycées doit être "la science qui se fait" dans les
laboratoires de recherche, il n'y a pas rupture entre les contenus et les
méthodes des enseignements secondaire et supérieur.
Cependant, il convient de signaler que le débat scientifique sur les points
abordés est parfois encore vif, les concepts, les méthodes d'investigations et de
modélisation étant très discutés.Pour les élèves du secondaire, la science est
sensée apporter des explications définitives et sans appel aux phénomènes
observés. Il est donc important de les sensibiliser au débat scientifique, de leur
faire prendre conscience que la science évolue dans ses concepts et ses
méthodes, et que les scientifiques sont prudents par rapport aux résultats de
leurs investigations et aux modèles proposés.
F. Les perspectives
Celles-ci s'inscrivent dans plusieurs registres :
- Sur le plan technique le plus immédiat, et dans le but de rendre aisément
accessible la démarche proposée, la réécriture d'une partie des instruments est
envisagée pour les rendre plus simples et pour les centrer sur des
fonctionnalités bien ciblées, avec un environnement attrayant et une bonne
convivialité. L'ensemble des logiciels pourrait fonctionner sur un réseau local,
ce qui permettra de partager les données initiales, facilitera la gestion des
fichiers produits par les élèves, offrira plus de souplesse au niveau de
l'impression..
- Nous avons construit notre approche en étudiant deux sites géographiques :
la région égéenne et la région du Japon. A moyen terme, il est souhaitable que
les enseignants aient le choix de différents sites de subduction qui illustrent
leur variété et qui mettent à l'épreuve la démarche et les outils informatiques
utilisés. D'autres travaux sont à envisager : région des Mariannes, des Andes,
des petites Antilles, etc. D'autres données sont également à rechercher et à
intégrer, telles que les données géochimiques du volcanisme associé aux
subductions, par exemple. La coopération avec des organismes tels que le BGI
pour franchir cette nouvelle étape pourrait être déterminante.
- Ce travail n'a abordé que les frontières de convergences avec subduction.
L'approche des ouvertures océaniques, intégrant, en plus, des données
magnétiques et de nouveaux outils de traitement et de modélisation, constitue
un prolongement logique, qui complétera les instruments utilisables en
géodynamique interne.
- La prise en main de cette démarche nécessite la maîtrise des méthodes
actuelles en géophysique et de l'utilisation des outils informatiques, ce qui
n'entre pas forcément dans la formation initiale de tous les enseignants. Il est
difficile d'actualiser d'un coup les connaissances dans tous les domaines de la
biologie-géologie. Aussi faut-il envisager une multiplicité d'actions dans ce
sens. Certains universitaires, par exemple, sont intéressés par la mise en place
d'approches similaires pour les travaux pratiques de DEUG ou de licence.
L'appropriation des instruments et l'adaptation de l'approche par les
enseignants en exercice appellent à l'évidence la conception de modules de
formation continue. Celle-ci ne peut pas être réalisée seulement par les
enseignants praticiens du secondaire (même s'ils sont expérimentés), mais doit
être dispensée par des enseignants-chercheurs géologues, pour garder un
niveau et une actualité suffisants.
BIBLIOGRAPHIE
- P r é s e n t a t i o n s et p u b l i c a t i o n s spécifiques :
- BAYER R., SARRAILH M., CULOS R., DUPOUY S., GROS C. : Essais de modélisation
par le traitement de données géophysiques d'un aspect de la tectonique des plaques : la
subduction. L'informatique scientifique dans l'enseignement de la biologie et de la géologie au
lycée. J.C. D U V A L et N. SALAME (Eds). - INRP, 1991, p. 77-84.
- CULOS R., D U P O U Y S., GROS C. : Essais de transfert dans l'enseignement des lycées
d'outils et de méthodes mis en pratique dans la recherche. Macro et micro regards sur la terre.
14° réunions des sciences de la terre. Toulouse Avril 92, Société Géologique de France, Paris.
- CULOS R., D U P O U Y S., GROS C. : Visualisation et modélisation graphique en géologie :
essai sur un aspect de la tectonique des plaques : la subduction. Bull, de l'EPI, n° 6 6 , 1 9 9 2 , p.
151-165.
- CULOS R., D U P O U Y S., GROS C. : Utilisation, traitement de données géophysiques et
modélisation dans le cadre de la subduction. Bulletin de l'APBG, n°4,1992.(à paraître).
- Logiciels :
- GRAMMAG : B. De CABISSOLE. Université de Montpellier II, 1989.
- COUPER : R. CULOS - INRP-MAFPEN de Toulouse.
- POLYDES : A. CULOS. Toulouse.
- SURFER : Golden Software.Inc. 807 14th Street P.O. Box 281 Golden. Colorado 80402.
GEOCOM, 2 rue Niepce, 75013 Paris.
- CD-ROM
- Global hypocenter data base information packet : 438 000 événements allant de -2100 à 1988.
- ISC Bulletin : informations plus complètes sur les séismes de 1964 à 1987.
Geological Survey National Earthquake Information Center. Denver Fédéral Center, B o x
25046, MS 967 DENVER, Colorado.
- Références
- ANGELIER J. : Néotectonique de la Grèce. Société Géologique du Nord.
- BELLON H., JARRIGE J.J., SOREL D. : Les activités magmatiques égéennes de
l'oligocène à nos jours et leurs cadres géodynamiques. Revue de géologie dynamique et de
géographie physique, vol.21, fasc.l p.41-55. Paris 1979.
- BONNIN J., OLIVET J.L. : Geodynamics of the Mediterranean région - Seismic Hazard in
Mediterranean régions. 1988.
- De CABISSOLE B. : Apports des données gravimétriques à la connaissance de la chaîne des
Pyrénées le long du profil ECORS. Thèse de doctorat, Université de Montpellier 11.1989.
- CNEXO : Les fosses helléniques. Résultats des campagnes à la mer n°23. Université PARIS
6, 1981.
- CNEXO : La marge et les fosses Helléniques. Campagnes Ariane et Egion du programme
HEAT. Résultats des campagnes à la mer n°23. Université PARIS 6 , 1 9 8 1 .
- GENTHON P. : Interprétation du géoïde altimétrique au-dessus de l'arc égéen. CNRS
Toulouse.
- HATZFELD D. : La méthode V A N pour la prédiction des séismes : pourquoi les
géophysiciens sont-ils sceptiques. La Recherche n°219 mars 1990.
- LE CLEAC'H A. : L'extrémité orientale de l'arc hellénique externe : structure et évolution
récente. Thèse de doctorat. Université PARIS 6.1984.
- LEQUELLEC. P. : La marge continentale ionienne au sud du Péloponèse : géologie et
structure. Thèse de doctorat. Géologie sous-marine. Université PARIS 6 . 1 9 7 9 .
- LEITE O. : La marge continentale sud Cretoise : géologie et structure. Thèse de doctorat.
Université PARIS 6. 1980.
- LE PICHON X. et JANGELIERJ. : The Aegean Sea. Phil.Trans R. Soc Land A 300. 1981.
- MACKENZIE D. : Active tectonics of the Alpine-Himalayan belt : the Aegean Sea and
surrounding région. Geophysics Jour. Astrom. Soc. 1978.
- MAKRIS J. : Geophysical Investigations of the Hellenides. Hamburg, 1977.
- MASCLE J., MARTIN L. : Shallow structure and récent évolution of the Aegean Sea : A
synthesis based on continuous reflection profiles. Marine Geology February 20, 1990.
- MERCIER J.L., SOREL D., SIMEAKIS K. : Changes in the state of stress in the overriding
plates of a subduction zone : the Aegean arc from the pliocène to the présent. Annale
Tectonicae, 1987.
- MERCIER J.L., SOREL D., VERGELY P., SIMEAKIS K. : Extensional tectonic regim in
the Aegean bassins during the cenozoic. 1989.
- NICHOLS. LA. Santorini volcano, Greece. Tectonic and petrochemical relationships with
volcanics of the Agean région. Tectonophysics, 11, 1971.
- KERANDREN B., SOREL D. : Relations entre sédimentation, tectonique et morphologie
dans le plio-pléistocène de Karpatos (Grèce) ; mouvements verticaux et datations
radiométriques. 1984.
- ERANDREN B., SOREL D., PAPAZACHOS B.C. : The active tectonics in the Aegean and
surrounding area - Seismic Hazard in Mediterranean régions, 1988.
- KERANDREN B., SOREL D. : The terraces of Corinthe (Greece) . A detailled record of
eustatic sea-level variations during the last 500 000 years, 1987.
- PAPAZACHOS.B.C. The active tectonics in the Aegean and surrounding area . Seismic
Hazard in Mediterranean régions. - 1988
- SOREL D., MERCIER J.L., KERAUDRAN B., CUSHING M. : Rôle de la traction de la
lithosphère subductée dans l'évolution géodynamique plio-pléistocène de l'arc égéen :
mouvements verticaux alternes et variations du régime tectonique. CR.Acad des Se. Paris,
1988.
- Ouvrages généraux
- DERCOURT J., PAQUET J. : Géologie. Objets et méthodes. Dunod Université. 1991.
- CARON J. M., GAUTHIER A. SCHAAF A., ULYSSE J., WOZNIAK J. : Comprendre
et enseigner la planète terre. Ophrys, 1989.
- NICOLAS A. : Les montagnes sous la mer. BRGM, 1990.
- DEBELMAS J., MASCLE G. : Les grandes structures géologiques. Masson, 1991.
- BOILLOT G. : Géologie des marges continentales. Masson, 19??.
- POIRIER J. P. : Les profondeurs de la terre. Masson ,1991.
- CAR A M. : Géophysique. Geosciences. Dunod, 1989.
- MESCHLER P. : Les méthodes de la géophysique. Dunod, 19??
- MADARIAGA R., PERRIER G. : Les tremblements de terre. Presses du CNRS, 1991.
- LAVERGNE M. : Méthodes sismiques. Editions Technip, 1986.
- DESAUBIES Y. et al. : Tomographie océanique et géophysique. Masson, 1991.
- BARDINTZEFF J.M. : Volcanologie. Masson, 1991.
- WESTPHAL M. : Paléomagnétisme et magnétisme des roches. Doin, 1986.
- LACOMBE H., COSTABEL P. : La figure de la terre du XVIIP siècle à l'ère spatiale.
Académie des sciences, 1988.
- ALLEGRE C. : Les fureurs de la terre. Editions Odile Jacob, 1987.
- LE PICHON X. : Kaiko : voyage aux extrémité de la mer. Editions Odile Jacob. 1986.
- TRYSTRAM F. : Le procès des étoiles Seghers, 1989.
- La terre : de l'observation à la modélisation. Courrier du CNRS 76. 1990.
- Modèles et modélisations, ASTER n° 7, INRP, 1988.
COMPRENDRE ET PRÉVOIR
LA DYNAMIQUE DES NAPPES D'EAU
J. Baly, P. Berche, J.-Y. Boulanger, B. Gérardin
C. Haguenauer, Bl. Janin, S. Klein
L'équipe est particulièrement
redevable à :
- M. DEMASSIEUX : Laboratoire de Géomécanique de l'École Nationale Supérieure
De Géologie de Nancy
- M. HAGUENAUER : Laboratoire de Géologie Appliquée au Génie Civil de l'Université
de Nancy I
- M. MAZENOT : Division Technique Générale, Electricité de France - Grenoble
pour leur participation
à ce travail et leur soutien scientifique
Elle adresse ses remerciements
concours :
à tous les universitaires
et technique.
et professionnels
qui lui ont apporté
leur
- M. RAMON : Agence Régionale de Bassin Rhin-Meuse, Nancy
- MM. BABOT et ROUGIEUX : Bureau de Recherches Géologiques et Minières, Nancy
- Mme GRANDBASTIEN et M. CHARPILLE : Centre de Formation à l'Informatique et à ses
applications pédagogiques (C.F.I.A.P.), Nancy
- M. SCHMITT : Centre InterRégional d'Informatique de Lorraine (C.I.R.I.L.), Nancy
- M. BUFFET : Compagnie des Salins du Midi et des salines de l'Est, Varangéville
- MM. PICARD et THÉPOT : Établissement Public pour l'Aménagement de la Loire et de ses
Affluents (É.P.A.L.A.) - Orléans
- MM. CAUSERO, BAUER et CHAPOT : Laboratoire Régional de l'Équipement de Nancy
Dans le cadre de sa politique de Mécénat Technologique et Scientifique,
Electricité de France a mis à la disposition de l'Institut National de Recherche
Pédagogique, ses compétences en matière d'auscultation d'ouvrages afin de
réaliser des logiciels d'écoulement souterrain.
C O M P R E N D R E E T P R E V O I R LA D Y N A M I Q U E
DES NAPPES D'EAU
75
J. Baly, P. Berche, J.-Y. Boulanger, B. Gérardin
C. H a g u e n a u e r , BL Janin, S. Klein
I. APPLICATIONS DE L'INFORMATIQUE EN GEOLOGIE APPLIQUEE
ET PLUS PRECISEMENT EN HYDROGEOLOGIE
A. La géologie appliquée, science prospective
B. L'hydrogéologie, science des modèles
C. Place de la géologie appliquée, particulièrement
de l'hydrogéologie, dans l'enseignement secondaire
IL ADAPTATION D'OUTILS PROFESSIONNELS ET CONSTRUCTION
D'UN NOUVEL OUTIL POUR L'ENSEIGNEMENT
A. Accessibilité des outils professionnels,
traditionnels et informatiques
B. Adaptation d'HYDROMOD, logiciel à caractère professionnel
1. Définition du modèle
2. Adaptation pédagogique d'HYDROMOD
conduisant au logiciel HYDROS.
3. Le menu et les principales fonctions d'HYDROS.
C. Création d'ÉCO L'ÈAU, un outil spécialisé
adapté au milieu scolaire
1. Définition du modèle
2. Structuration pédagogique d'ÉCO L'EAU
III. APPLICATION PÉDAGOGIQUE DES OUTILS ADAPTÉS
A.Utilisation du logiciel HYDROS pour comprendre et représenter
dans l'espace la dynamique d'une nappe
1. Activités des élèves
2. Évaluation des résultats de l'expérimentation
d'HYDROS en classe
B. Utilisation du logiciel ECO L'EAU pour comprendre
et représenter la dynamique temporelle d'une nappe d'eau
1. Activités des élèves
2. Évaluation des résultats de l'expérimentation
d'ÉCO L'EAU en classe
C. Perspectives offertes par les logiciels
ECO L'EAU et HYDROS
75
75
78
81
84
84
85
85
87
90
93
93
97
105
105
105
113
120
120
130
138
COMPRENDRE ET PRÉVOIR
L A D Y N A M I Q U E DES N A P P E S D ' E A U
La géologie appliquée intègre aujourd'hui un nombre croissant de
connaissances à base d'informations numériques que les moyens informatiques
permettent de saisir, de stocker et de traiter rapidement dans une perspective
prédictive d'exploitation des ressources corrélée à la prévention des risques.
L'hydrogéologie constitue un domaine où l'efficience de l'ordinateur s'est
manifestée avec une précocité suffisante pour permettre d'opérer une
transposition effective sinon immédiate pour l'enseignement des concepts et des
méthodes actuellement en vigueur dans ce domaine de la géologie appliquée.
I. APPLICATIONS DE L'INFORMATIQUE EN GÉOLOGIE APPLIQUÉE
ET PLUS PRÉCISÉMENT EN HYDROGÉOLOGIE
La géologie appliquée exploite des données nombreuses, significatives de la
variation spatio-temporelle des phénomènes. Les données recueillies et les
informations déduites participent au caractère prospectif de cette science qui
joue un rôle décisif dans des domaines où les enjeux économiques et humains
s'avèrent considérables.
A. L a géologie appliquée, science prospective
1. En vue de répondre à des questions d'économie et de sécurité, la
surveillance lithologique et structurale des sites utilise l'ordinateur pour
exploiter les données immédiates reçues par des capteurs. Trois pistes se
dessinent dans ce domaine.
a. Le Laboratoire Régional de l'Équipement de Nancy-Tomblaine pratique
l'étude de la subsurface par sismique-réfraction.
Un logiciel créé pour cette technique exploite les données de terrain relatives
aux vibrations reçues par des géophones. L'ordinateur calcule la vitesse des
ondes produites par un ébranlement provoqué, ce qui permet de déduire les
caractéristiques structurales du substratum. Le traitement des données aboutit à
une coupe géologique en termes de résistance mécanique. Le professionnel
accède ainsi indirectement, sans forages coûteux, aux propriétés mécaniques
des formations géologiques jusqu'à 50 mètres de profondeur. Cette approche
permet de prévoir le mode d'extraction des matériaux du sous-sol. C'est un
outil d'aide à la décision.
b. La Compagnie des Salins du Midi et des Salines de l'Est à Varangéville
opère grâce à l'ordinateur un suivi préventif de la progression des cavités de
dissolution dues à l'exploitation du sel.
Un logiciel, propriété de la Société P R A K L A - S E I S M O S , construit
l'échogramme des cavités de dissolution à partir des données échométriques
acquises par une sonde d'écho. Il exploite et affine à la fois la connaissance des
caractéristiques lithologiques et structurale du gisement sédimentaire. La
représentation graphique de la forme et des dimensions des cavités de
dissolution vise à optimiser l'exploitation du sel tout en évitant les
effondrements non prévus.
c. Le Service d'Auscultation de la Division Technique Générale
Grenoble pratique la surveillance des grand ouvrages.
E.D.F.
à
Un logiciel important réalisé par Monsieur MAZENOT, Ingénieur responsable
du service, mobilise les télémesures fournies par les capteurs de mouvement
implantés dans les ouvrages. Le traitement graphique des données permet de
visualiser les déplacements dans le temps. Pour dégager l'incidence relative des
différents facteurs, parmi lesquels ceux d'origine géologique, les valeurs sont
corrigées des mouvements d'origine climatique. L'auscultation continue des
barrages permet de déceler très tôt une anomalie dans leur fonctionnement.
Mais le stockage et le traitement statistique des données nombreuses relatives
aux différents facteurs de variations implique un matériel très puissant.
Ces logiciels professionnels tournent sur des matériels sans rapport avec les
moyens du milieu scolaire, ce qui empêche le transfert immédiat dans les
classes au moyen de l'informatique des concepts sous-jacents à leur emploi dans
la surveillance lithologique et structurale des sites.
2. Dans la perspective d'une rationalisation de l'urbanisation, un relevé de
sondages géotechniques, constituant une banque de données a fait l'objet d'un
traitement graphique par ordinateur.
Le CIRIL (Centre InterRégional d'Informatique de Lorraine) utilise le
progiciel C A D D S (COMPUTERVISION) pour traiter les données des sondages
réalisés sur le district urbain de Nancy (D.U.N.).
Parmi un ensemble d'applications très ouvert, la cartographie à deux ou trois
dimensions rend exploitables les données topographiques et géologiques.
L'activation de la base de données permet de disposer, sur le quadrillage
Lambert, des sondages du secteur choisi. A la demande, un fond topographique
apparaît (courbes de niveau, pentes d'isovaleur, etc.) de même que la
planimétrie (espaces verts, etc.). L'accès à l'ensemble des sondages présentant
certaines caractéristiques est permis. Leur log géologique peut être appelé. Des
graphiques sont possibles pour traduire les résultats des essais géotechniques
stockés dans la base de données (pénétrométrie, etc.).
A condition d'utiliser un logiciel moins lourd, tel M I C R O C A D D S qui
fonctionne sur matériel scolaire, ce travail pourrait donner lieu à des
applications utilisables dans l'enseignement secondaire, dans les classes
préparatoires aux grandes écoles et pour l'enseignement des classes de
techniciens supérieurs en géologie. A partir de la banque de données, des
corrélations hydrologiques, lithologiques, géochronologiques entre sondages
pourraient être établies pour représenter une nappe d'eau ou pour reconstituer
des variations de lithofaciès dans l'espace et dans le temps.
Compte tenu de la faible profondeur de la plupart des forages du district
urbain de Nancy, la banque de données, par ailleurs difficilement disponible,
limite les possibilités d'application du progiciel pourtant riche de promesses
d'interactivité pour l'enseignement de la géologie. Mais de riches données
existent sur les faciès salifères du Keuper, qui permettraient de construire les
corrélations à distance entre forages.
Un travail de recherche pourrait justifier la saisie sur ordinateur des
informations exploitées jusqu'ici manuellement pour reconstituer la dynamique
des milieux à évaporites du Keuper de l'Est de la France. Ainsi exploité,
M I C R O C A D D S rendrait les services d'un logiciel professionnel du B.R.G.M. :
A C T I F (Acquisition et Traitement des Informations de Forages), non
transposable tel quel dans l'enseignement compte tenu de sa taille et de son
niveau technico-scientifique élevé.
3. La prévision des risques fait appel à l'ordinateur pour estimer les
coefficients de sécurité. La prise en compte, dans le calcul, des données
topographiques et piézométriques de terrain, corrélées à la cohésion et à la
masse volumique des matériaux, offre une ouverture intéressante pour
l'enseignement.
a. Le Laboratoire Régional de l'Équipement de Nancy-Tomblaine réalise de
telles expertises. Le logiciel PETAL a pour objectif de déterminer le coefficient
de sécurité lorsque des indices laissent entrevoir un risque de glissement de
terrain ou, si ce dernier a eu lieu, d'apprécier son degré d'évolution pour
savoir s'il est stoppé.
Logiciel de simulation, P E T A L assure la visualisation dans l'espace et la
prévision dans le temps du profil du terrain, effet de l'action conjuguée des
principaux facteurs de stabilité. En cas de pronostic défavorable, il permet de
prévoir l'incidence de travaux et de choisir l'intervention qui suffirait pour
stabiliser les pentes. En permettant de poser un diagnostic raisonné, il constitue
un outil d'aide à la décision.
b. Dans la mesure où des travaux de drainage suffisent pour accroître le
coefficient de sécurité, le problème posé à l'expert porte en grande partie sur
une connaissance hydrogéologique. Ce thème est une spécialité de M. Mazenot à
la Direction Technique Générale d'E.D.F. chargée, à Grenoble, de la
surveillance hydrogéologique des grands ouvrages.
B. L ' h y d r o g é o l o g i e , science d e s m o d è l e s
1. La représentation des phénomènes hydrogéologiques par des modèles aide
à maîtriser les échelles de l'espace et du temps. L'exploitation et la surveillance
hydrogéologique des sites donne lieu à une grande quantité de valeurs qui font
l'objet de modélisations visant à simuler l'évolution des nappes d'eau. La place
importante faite aux modèles dans les logiciels d'hydrogéologie reflète tout à la
fois la nécessité et l'impossibilité matérielle de mener une étude en vraie
grandeur. La complexité du réseau d'interactions hydrosphériques,
atmosphériques, lithosphériques et biosphériques rend inaccessible
l'expérimentation et difficiles les simplifications.
Dans une approche systémique, l'observateur hydrogéologue analyse les
paramètres pour tenter d'établir les relations entre eux dans un modèle
explicatif nécessairement remodelable. Dans le domaine de la science appliquée
où la réalisation finale ne souffre aucune erreur d'appréciation, le caractère
prévisionnel s'impose aux plans qualitatif comme quantitatif. D'abord
physiques -hydrauliques et électriques- les modèles hydrogéologiques
deviennent mathématiques et fonctionnent sur ordinateur : ces modèles
numériques informatiques deviennent de plus en plus abstraits, ce qui impose
de les valider à l'aide des précédents avant le verdict du passage à l'action.
La modélisation des phénomènes doit s'ajuster au réel de conditions définies,
vécues ; après ce contrôle, elle peut enfin assurer la simulation d'une possible
évolution dans des conditions nouvelles, déterminées par la variation des
facteurs pris en compte dans le modèle.
En milieu professionnel, la formalisation du réel ne constitue pas une simple
spéculation intellectuelle, la modélisation des relations entre grandeurs n'est pas
l'œuvre d'un simple utilisateur. Le concepteur crée des modèles probables que
le praticien exploite.
Moyen d'exploration et d'anticipation utilisé pour les simulations, le modèle
doit permettre de prévoir l'évolution hydrogéologique d'un site. Produits
conceptuels, les modèles sont substitués au réel pour le représenter, non pour le
remplacer. Si le modèle hypothétique n'est pas confirmé par les nouvelles
confrontations avec le réel, il perd sa fonction opératoire et sera adapté, ou
reconstruit.
2. Les modèles hydrogéologiques informatiques examinés proviennent du
domaine universitaire à vocation préprofessionnelle et du milieu industriel.
a. Plusieurs modèles mathématiques à caractère professionnel concernant le
rabattement d'une nappe autour d'un puits et la circulation de l'eau dans un
domaine sous barrage ont été produits par les Enseignants de l'LU.T. de Génie
Civil de l'Université de N A N C Y I. Réécrits à la faveur d'un stage de formateurs
en informatique [J.P. Fischer, C. Haguenauer, 1985] pour les rendre interactifs
et accélérer les calculs, ces produits sont restés accessibles sur un seul matériel.
Ils n'ont donné lieu qu'à d'exceptionnelles utilisations en classe mais ils ont
orienté les recherches scientifiques et pédagogiques.
b. L'Agence de Bassin Rhin Meuse dispose d'une banque de données
climatiques et piézométriques. En mesure de calculer l'évapotranspiration, le
logiciel de traite- ment statistique utilisé estime les réserves d'eau souterraine
d'un lieu à un moment donné. Outil d'aide à la décision, il permet de choisir le
site d'installation d'un pompage et le débit optimal à lui appliquer ; mais la
faible ancienneté des mesures piézométriques limite la précision des
simulations.
c. Pour la surveillance hydrogéologique de ses ouvrages, E . D . F . dispose de
toutes les données de la Météorologie Nationale qui viennent éclairer les
nombreuses mesures de pression interstitielle et de débit. Ensemble, elles
constituent une immense banque de données regroupant des décennies
d'observations pour les ouvrages les plus anciens. Pilotées par un logiciel
professionnel, elles participent à une modélisation de la dynamique de l'eau qui
permet de contrôler le bon fonctionnement des nappes sous les ouvrages, donc
de prévenir les risque.
d. La Société S O B E A de PONT-A-MOUSSON exploite des puits situés dans la
boucle alluviale de l'Obrion et de la Moselle, sur le site de Loisy : un secteur
urbanisé en pleine évolution.
Des précautions s'imposent pour limiter les risques de pollution de l'eau. Les
nombreuses mesures piézométriques réalisées à proximité des captages par
l'équipe de M. Demassieux, Professeur au laboratoire de géomécanique de
l'École Nationale Supérieure de Géologie, ont permis la production d'un
modèle hydrogéologique informatique, le logiciel H Y D R O M O D qui vise à
comprendre et à prévoir la dynamique spatio-temporelle de la nappe alluviale.
e. Des documents réalisés pour le compte de la Direction Départementale de
l'Équipement de la Haute Loire et de l'Établissement Public Régional de la
Loire et de ses Affluents, font apparaître le caractère préventif des simulations
dans le domaine des changements hydrauliques liés à l'implantation des grands
ouvrages.
Réalisés par l'ÉPALA (Établissement Public pour l'Aménagement de la Loire
et de ses Affluents) à Orléans et par la R É A L (Région d'Équipement des
Alpes/Lyon) à Chambéry, ils présentent des images numérisées qu'ils modifient
en exploitant les relevés hydrologiques, hydrogéologiques et géologiques
rassemblés sur le bassin versant de la Loire. La base de données mobilisée pour
les modélisations sert pour simuler l'impact du barrage et de la retenue
projetés à Serre de la Fare : impact sur l'environnement, sur la gestion de l'eau
dans la prévention des crues et sur la sécurité.
Destinés à informer le grand public de façon objective, ces documents
permettent de sensibiliser les élèves. Riche d'informations, ils illustrent
l'importance du traitement informatique des données, passées et actuelles, pour
prévoir l'évolution d'un site soumis à l'influence de l'homme. Mais, si leur
création a déterminé, comme dans l'enseignement, la fragmentation d'un
problème de géologie appliquée d'approche multifactorielle, la solution
apparaît toute faite dans le produit fini : disponible en vidéocassette, il ne
permet pas de construire une réelle analyse de l'incidence relative des
différents facteurs, actuels ou passés, dans l'évolution hydro-géologique du site.
3. Le soutien apporté par MM. Demassieux et Mazenot oriente vers l'étude
des logiciels de modélisation du fonctionnement des nappes d'eau utilisés à
l'E.N.S.G. et à E.D.F. L'exploitation de ces logiciels permet de simuler, dans des
conditions nouvelles, le comportement des nappes d'eau de sites bien
déterminés et assure une prévision hydrogéologique précise. Elle mobilise les
mêmes notions que les outils professionnels généraux, de haute technicité
scientifique mais de très grande taille et fort coûteux, diffusés par le B.R.G.M. :
B A D G E (Bases de Données pour la Gestion des Eaux) et G A R D E N I A (modèle
Global A Réservoirs pour la simulation des DÉbits et des Niveaux Aquifères).
Les dimensions des logiciels professionnels rendant impossible leur transfert
direct dans l'enseignement, Monsieur MAZENOT a écrit ECO L'EAU, un modèle
construit de toutes pièces pour être utilisable sur matériel scolaire. Pendant ce
temps, Monsieur D E M A S S I E U X adaptait H Y D R O M O D pour le rendre accessible
sur compatible P.C. Ce modèle hydrogéologique convenait initialement pour
une nappe alluviale ; Messieurs M A Z E N O T et D E M A S S I E U X ont fourni les
éléments mathématiques permettant de l'utiliser pour simuler la dynamique de
l'eau d'une nappe sous un barrage ; il s'est ainsi trouvé généralisé aux deux
types de nappes, libres et captives, avant d'être adapté pour une utilisation dans
les classes.
Trois problèmes interdisciplinaires, avec une composante géologique,
motivent l'essentiel de cette étude : la connaissance des nappes d'eau, tant sous
l'aspect de la quantité, donc en termes de gestion, que de la qualité, déterminée
ici par la pollution, ainsi qu'au plan de la sécurité liée aux risques de glissement
des terrains entraînés par l'eau. Le fil conducteur de la recherche apparaît : la
circulation de l'eau des nappes pour lesquelles on dispose de données réelles
susceptibles de permettre un aller et retour de l'observation à la simulation en
passant par la modélisation.
C. Place de la géologie appliquée, particulièrement
de l'hydrogéologie, dans l'enseignement secondaire
1. La géologie appliquée présente une composante prévisionnelle. Elle doit
répondre aux interrogations en termes de prévention et de sécurité. Elle
anticipe dans la durée l'incidence des facteurs de l'environnement sur
l'évolution des grands ouvrages ou sur la dynamique des nappes phréatiques.
C'est un domaine de la géologie où les conséquences économiques et humaines
des diagnostics sont considérables et où l'utilisation de l'informatique permet
une modélisation scientifiquement construite, aux enjeux importants.
Dans l'approche scolaire de la géologie, l'application vaut pour le seul
professeur ; elle n'est pas effective pour l'élève qui construit, à partir
d'exemples particuliers, ses premières étapes d'induction vers quelques
problèmes liés aux ressources géologiques locales. Les développements centrés
sur l'aspect historique élargissent la vision de l'espace et du temps en favorisant
l'hypothético-déduction. La géologie appliquée met l'élève en situation
d'exploiter son nouveau savoir dans une démarche déductive appliquée à la
gestion des nappes d'eau ou à la détection et à la prévention de risques naturels
tels que les glissements de terrain. Mais une enquête auprès des professeurs qui
suivent à Nancy les stages de formation continue en géologie appliquée montre
qu'ils trouvent rarement le temps de conduire cette réflexion géologique finale
au collège.
C'est au lycée que les problèmes de géologie appliquée prennent de
l'importance. A l'enseignement de la géologie historique tourné vers la
tectonique globale s'ajoute l'indispensable ouverture à la responsabilité
scientifique de l'homme en géologie.
Cette responsabilité s'exerce dans la mise en valeur des milieux naturels, par
exemple par la réalisation d'un grand ouvrage de génie civil, et dans
l'évolution des grands équilibres de la biosphère, par exemple dans une étude
prospective des risques de pollution ou dans la protection des sites. L'exemple
des barrages permet d'atteindre ce double objectif de construction raisonnée et
de protection des sites. Il impose une approche interdisciplinaire.
La nécessaire prise en compte de l'apport de spécialistes variés dans
l'évaluation chiffrée des risques réclame l'aide de l'ordinateur pour simuler
l'impact de l'ouvrage et pour dégager l'incidence des principaux facteurs de
risque dans un domaine où il est difficile de faire apparaître de façon directe et
précise le rôle spécifique de la géologie. Parmi les acquis conceptuels
dominants d'une approche scolaire de ces problèmes par les logiciels
professionnels figure la compréhension des modèles de sciences appliquées.
Construits ou adaptés pour la circonstance, ils permettent et appellent un retour
permanent aux données du réel donc une confrontation des résultats prévus par
le modèle aux mesures effectives, c'est à dire une démarche commune aux
sciences expérimentales.
2. Les problèmes d'hydrogéologie appliquée liés à la dynamique des nappes
d'eau s'expriment en termes de qualité, de quantité et de sécurité. Compte tenu
de la multiplicité des facteurs et de la complexité de leurs interactions, le
professionnel qui utilise les logiciels est aidé par l'hydrogéologue concepteur
des modèles.
Au collège et surtout au lycée, la notion de ressources en eau, considérée à
partir d'exemples régionaux, porte sur leur origine et sur les problèmes posés
par leur exploitation et par leur protection : questions d'actualité dont la
réponse passe par les concepts de capacité d'alimentation, de conditions de
circulation des eaux souterraines, de propriétés liées aux caractères
lithologiques et structuraux des roches, de facteurs d'évolution des nappes, de
renouvellement et de gestion des ressources. La nécessité de les traiter de façon
dynamique, à la fois qualitative et quantitative, rend pratiquement
indispensables les simulations donc l'utilisation de l'ordinateur pour mobiliser
les nombreuses données dans des modèles dynamiques de nappes. Comme le
professionnel, l'élève mis en situation de recherche pour répondre à un
problème de pollution de nappe, d'épuisement de celle-ci ou de risque lié à
l'implantation d'un ouvrage, peut comparer ses propres diagnostics à ceux que
lui fournissent les logiciels.
3. L'importance opératoire de la modélisation apparaît comme l'objectif
conceptuel dominant de cette approche par les logiciels professionnels. Utiliser
ces modèles pour la formation dans les classes, c'est décider de refuser celles
des expérimentations qui faussent les échelles, c'est donner aux élèves les
moyens d'employer les logiciels comme les utilisateurs, voire de construire,
sinon de créer de toute pièce des modèles fonctionnels.
Dans un va-et-vient du concret à l'abstrait avec retour au concret, les logiciels
professionnels offrent une source de mobilisation complète des différentes
démarches scientifiques : l'analyse conduisant au modèle fait intervenir
l'induction créatrice du modèle à caractère prévisionnel et la déduction dans
son application par la simulation à caractère décisionnel.
Offrir aux élèves la possibilité d'utiliser ces outils, c'est vouloir les entraîner
à la méthode déductive que la géologie appliquée favorise largement. De la
plausibilité du modèle employé dans une situation nouvelle naît le
renforcement, de l'absence de cohérence avec les faits naît le rejet. En
répondant à des problèmes concrets tels que définir une zone de vulnérabilité,
tracer une route en prévenant les risques, prévoir un débit de pompage sans
épuiser la nappe, diminuer les pressions sous-barrage pour accroître le
coefficient de sécurité de l'ouvrage, l'élève est conduit vers une explication
scientifique des phénomènes.
Au travers de problèmes réels se dégagent ainsi les concepts scientifiques qui
constituent des objectifs cognitifs dominants de notre enseignement :
- l'idée que les ressources en eau, en termes de qualité et de quantité, sont
soumises à des influences multifactorielles : précipitations, température, etc.
- la notion de nappe d'eau souterraine associée au concept d'écoulement dans
un aquifère : il importe de bousculer l'image tenace, solidement ancrée dans les
croyances depuis l'Antiquité, de l'eau souterraine, circulante ou piégée dans des
cavités indépendamment de tout aquifère ; cette conception ne peut évoluer
qu'avec la démonstration de la circulation de l'eau des nappes pour substituer à
une certitude infondée l'idée de leur dynamique dans leur aquifère,
- le concept de fonctionnement des nappes exprimé en termes prévisionnels de
réserves et de vulnérabilité,
- l'idée qu'il faut connaître les conditions de la circulation de l'eau des nappes
pour résoudre les problèmes posés par leur exploitation et par leur protection.
II. ADAPTATION D'OUTILS PROFESSIONNELS ET CONSTRUCTION
D'UN NOUVEL OUTIL POUR L'ENSEIGNEMENT
A. Accessibilité des outils professionnels,
traditionnels et informatiques
Les outils informatiques prolongent les études traditionnelles en assurant une
quantification plus précise des phénomènes. Ils permettent de cerner de façon
plus rigoureuse la frange de compatibilité entre l'exploitation des ressources et
la réduction maximale des risques.
1. Les documents traditionnels du géologue ne sont pas remplacés par le
matériel informatique. Les photographies aériennes, les cartes, les échantillons
lithologiques des sites étudiés dans les logiciels gardent la priorité dans le temps
de la recherche appliquée. Ils doivent rester les premiers dans les
apprentissages. Devenus préalables au travail sur ordinateur qui les complète,
ils continuent d'assurer la formulation des problèmes que les logiciels clarifient
dans la recherche d'une solution. Transférées sur P.C., une partie des mesures
météorologiques, piézométriques et lithologiques constituent les données qui
assurent le fonctionnement des modèles.
2. Les modèles professionnels informatiques permettent à l'utilisateur de
simuler différentes conditions pour apprécier l'incidence de la variation des
facteurs de l'environnement sur une nappe d'eau. Il apparaît tentant d'opérer le
transfert à l'enseignement de ce type de méthode, proche d'une démarche
expérimentale. Mais les logiciels professionnels consistent dans des
programmes de calculs longs et puissants, au départ inaccessibles à la classe. Ils
ne deviennent transposables qu'à la condition de les refaire pour travailler sur
compatible P.C. tout en veillant à ce que l'adaptation de leur vocabulaire et de
leur scénario rende possible leur utilisation.
La visualisation des phénomènes ne paraît pas indispensable au professionnel
si les valeurs affichées à l'écran s'ancrent dans son vécu personnel. Elle
constitue un élément de la transformation du logiciel quand les nombres restent
sans signification pour son utilisateur. Une fois adapté ou (re)construit à des
fins didactiques, le produit doit ensuite être réajusté progressivement en
fonction des réactions des premiers utilisateurs : successivement, les
professeurs du groupe de recherche, les professeurs et les élèves des lycées
participant à l'expérimentation et enfin les professeurs qui ont choisi
d'approfondir leurs connaissances en géologie appliquée dans le cadre des
stages de formation continue. Peu à peu, au fur et à mesure de l'avancement de
la recherche, les transformations évoluent dans le sens d'une interactivité
croissante et d'une définition de plus en plus précise des concepts, en relation
avec les objectifs de l'enseignement de la géologie dans l'enseignement
secondaire.
B. Adaptation
d'HYDROMOD,
logiciel
à
caractère professionnel
1. Définition du modèle
a. H Y D R O M O D constitue un outil de formation des ingénieurs à l'École
Nationale Supérieure de Géologie. La complexité du système d'équations du
modèle le rend inaccessible à un non spécialiste : à partir de données
géologiques et hydrogéologiques relevées localement sur le site, l'ordinateur
calcule le potentiel hydraulique ou niveau piézométrique de tous les points de la
nappe situés aux nœuds d'une grille définie à l'avance et superposée à la carte
d'un réservoir souterrain. Une reconnaissance préalable permet au géologue
hydrogéologue de définir :
- les frontières naturelles du système,
- la répartition spatiale des caractéristiques de la perméabilité,
- la répartition des débits d'apport et de soutirage sur le domaine ou à ses
frontières (puits, infiltration, ruissellement),
- la répartition des limites à potentiel hydraulique déterminé (plans d'eau).
Les différences de potentiel hydraulique causent les mouvements de l'eau.
Comme on ne peut déterminer l'écoulement dans un volume complexe, on
utilise un modèle de calcul par éléments finis : la surface piézométrique de la
nappe est découpée en mailles assez petites pour que Ton puisse considérer que
le potentiel hydraulique y varie de façon linéaire dans les différentes
directions. Partant ainsi de l'hypothèse d'un écoulement laminaire de l'eau, la
solution recherchée doit satisfaire, en régime permanent c'est à dire dans la
nappe en équilibre, à une loi de conservation qui s'exprime par l'égalité entre
la somme des entrées et la somme des sorties pour chacune des mailles du
domaine : la quantité qui entre par le (s) coté (s) entrant (s) égale celle qui
ressort par le (s) cotés sortant (s). Un algorithme de type itératif assure la
précision des calculs.
L'efficacité du modèle dépend de la finesse du maillage, fruit de l'expérience
du modéliseur qui prévoit les plus petites mailles dans les zones où les
variations du potentiel sont les plus grandes, par exemple dans une zone de
pompage. Les limites de validité du modèle sont fixées avant tout par la qualité
de la reconnaissance préalable qui fournit les données peu nombreuses utilisées
par le modèle. Plus valables que les mesures de laboratoire sur échantillon
forcément remanié, les mesures de perméabilité ont lieu sur le terrain, entre
les forages d'une station d'essai. La détermination des débits reste du domaine
du savoir de l'expert. Les niveaux piézométriques ou potentiels hydrauliques
aux limites du modèle s'obtiennent par des mesures dans les piézomètres et
dans les cours d'eau. L'enveloppe des hauteurs piézométriques ou surface
piézométrique de la nappe, représente la nappe.
Elle est dessinée sur un plan en courbes d'égal niveau piézométrique ou
courbes isopièzes. L'ordinateur trace, maille après maille, les lignes
équipotentielles ou lignes isopièzes de la surface supérieure de la nappe. Cellesci renseignent sur la dynamique de la nappe dans le domaine étudié.
b. H Y D R O S réutilise le modèle par éléments finis d'HYDROMOD pour déduire
des isopièzes les lignes d'écoulement ou lignes de courant.
Dans un milieu isotrope, l'eau coule perpendiculairement aux équipotentielles.
A partir de la direction des équipotentielles, l'ordinateur calcule et trace,
maille après maille, les lignes de courant. H Y D R O S étend aux barrages-poids le
modèle de calcul et de représentation de l'écoulement de l'eau en traçant les
lignes équipotentielles et les lignes courant dans un plan vertical du domaine
sous barrage. Il permet de simuler l'influence de travaux confortatifs dans une
fondation : un maillage fin de la zone d'intervention conduit à évaluer
l'influence des changements de conditions hydrodynamiques qu'entraîneraient
l'injection d'un voile d'étanchéité, de perméabilité inférieure à celle de la
fondation, et/ou la réalisation d'un voile de drainage imposant localement un
potentiel hydraulique très faible. H Y D R O S évalue en outre les conséquences de
la piézométrie sur la stabilité de l'ouvrage en déterminant le coefficient de
sécurité du barrage au renversement sur le pied aval. Les calculs portent sur
une tranche de barrage unitaire suivant le plan amont-aval. Le logiciel tient
compte des trois forces principales qui agissent sur cette tranche d'ouvrage :
son poids, la poussée de l'eau sur le parement amont, les forces de pression,
dites de sous-pression qui s'exercent sur la fondation du barrage.
- V étant le volume de l'ouvrage de hauteur H et de base B x 1 et Mv la masse
volumique du béton, le poids s'obtient par V x Mv soit ((H x B) / 2) x Mv.
- Pour un barrage dont la section est un triangle rectangle, le moment Mp du
poids s'obtient par ( H x B) / 2) x Mv x (2 B / 3) soit (H x B 2 x Mv) / 3.
- La poussée de l'eau sur le parement amont s'obtient par (H / 2) x H x 1 et
le moment de cette force par rapport au pied aval par ( H 2 / 2) x H / 3 soit
H3/6.
La poussée des sous-pressions à la base de l'ouvrage varie avec le potentiel
hydraulique. Conséquence de la pression d'eau qui s'exerce sous le barrage,
elle se déduit du potentiel hydraulique calculé par H Y D R O M O D . On l'obtient en
faisant la somme des poussées élémentaires qui s'exercent sur chaque maille.On
calcule le moment total des sous-pressions, en faisant la somme des moments de
ces poussées élémentaires par rapport au pied aval.
- Le moment du poids est stabilisateur, les autres déstabilisateurs. Le
coefficient de sécurité au renversement autour du pied aval est obtenu par le
rapport des moments stabilisateurs aux moments déstabilisateurs. La stabilité
est théoriquement assurée dès que le coefficient est supérieur à 1. Dans la
pratique, on exige un coefficient de sécurité plus grand.
Ainsi, les calculs puissants opérés par H Y D R O M O D sur des paramètres
physiques permettent les opérations simples d'HYDROS. La méthode d'approche
des faits par le modèle professionnel, appuyé sur les lois fondamentales de la
physique, en fait un modèle déterministe.
2. Adaptation pédagogique d'HYDROMOD conduisant au logiciel H Y D R O S .
Les premières modifications ont eu pour but d'améliorer la qualité de
l'affichage et l'ergonomie du produit. Des pages d'aide facilitent le
cheminement dans l'utilisation du logiciel et l'emploi du clavier. Le logiciel
s'enrichit d'un vocabulaire scientifique adapté. Enfin, l'impression d'écran est
possible. L'hydrogéologue déduit généralement mentalement les lignes de
courant de la carte des isopièzes. La transformation pédagogique du logiciel a
permis d'introduire le tracé des lignes de courant que l'élève choisit de dessiner
lui-même à l'écran ou de faire afficher par l'ordinateur (fig. 1).
MODELE :
LOIS9210
FICHIER :
YETESP31
POT.
MIN
178.SO
POT.
MAX
180.20
EQUIDISTANCE
0.057
I
Tracé
<A>utonatique
p a s à pa<S>
180.20
nan<U>el
<E>dition
<F1>
<F>in
<C>
<U> <?>
<ESC>
Fig. 1.- Simulation des isopièzes de la nappe de Loisy en été, et construction
des lignes de courant facilitée par l'aide technique correspondante.
Plus lisibles que les lignes isopièzes, les lignes de courant constituent un outil
pédagogique au service de l'élève pour indiquer le cheminement de l'eau ou
d'un polluant.
Outre l'affichage des équipotentielles et des lignes de courant par
l'ordinateur, l'utilisateur a la possibilité de tracer lui-même des lignes
quelconques à l'écran.
Suivant le problème posé, elles peuvent correspondre au tracé d'un périmètre
de protection autour d'un puits, ou bien simuler le passage d'une route afin de
déterminer l'incidence, en matière de pollution, du déversement d'un produit
toxique sur son parcours ou encore représenter des lignes de courant d'une
nappe alluviale ou d'un domaine sous barrage (fig. 2).
MODELE :
BARRAGE
FICHIER :
BARRAGE
POT.
O.OO
Uous conseruaz
cette
ligne
MIN
O/N
^Fl>
<Ç>
<U>
<?>
<ESC>
Fig. 2.- Simulation
montrant la correction qu'apporteraient
un voile
d'injection très peu perméable et un voile de drainage à la circulation de l'eau
dans l'aquifère situé sous un barrage-poids : en déportant les lignes de courant,
les voiles limitent les forces de sous-pression qui risqueraient de déstabiliser
l'ouvrage. Le vocabulaire précise les concepts.
Quand la simulation porte sur l'aquifère seul, l'affichage du bloc diagramme
de la nappe montre la forme de la surface piézométrique (fig. 5) ; quand elle
concerne un barrage et l'aquifère sous-jacent, l'option sécurité du barrage
permet d'appliquer à l'ouvrage en projet les forces qui s'exerceraient sur lui et
d'en déduire le coefficient de sécurité au renversement aval du barrage (fig. 3).
Les expérimentations dans les classes ont fait apparaître l'intérêt de pouvoir
modifier les conditions hydrodynamiques afin de visualiser immédiatement
l'effet de ces changements par de nouvelles simulations pour, éventuellement,
créer de nouveaux fichiers de travail. L'introduction de nouvelles valeurs des
paramètres est possible en appelant H Y D R O M O D directement, par le menu
d'HYDROS. Un éditeur permet la saisie des nouvelles données.
MODELE :
BARRAGE
FICHIER :
BARRAGE
Fig. 3.- Schéma des forces qui s'exercent sur un barrage-poids et coefficient
de sécurité du barrage avec un voile d'étanchéité et un voile de drainage dont
les caractéristiques sont rappelées dans l'aide technique.
3. Le menu et les principales fonctions
d'HYDROS.
MENU PRINCIPAL
1.
2.
3.
4.
5.
6.
7.
8.
9.
Fig. 4.Loisy en
alentours
potentiels
CHANGER DE FICHIER DE TRAVAIL (fichier actuel : BAR1)
AFFICHER LE MAILLAGE
AFFICHER DES LIGNES ÉQUIPOTENTIELLES
AFFICHER DES LIGNES ÉQUIPOTENTIELLES ET LE MAILLAGE
TRACER DES LIGNES DE COURANT
AFFICHER UN BLOC DIAGRAMME DE LA NAPPE ET DES COUPES
ACCÉDER A HYDROMOD
CHARGER LES UTILITAIRES
QUITTER LE PROGRAMME
Lignes équipotentielles tracées par l'ordinateur dans la nappe de
été, en présence de deux puits. Les mailles sont plus petites aux
des puits, zone dans lesquelles il est nécessaire de déterminer les
hydrauliques avec plus de précision.
Dans l'option 5, l'ordinateur propose le choix entre un tracé automatique des
lignes de courant, un tracé pas à pas qui se poursuit progressivement, maille
après maille ou un tracé manuel dont la signification dépend du choix de
l'utilisateur. L'édition permet de supprimer une ou toutes les lignes, manuelles
ou automatiques tracées à l'écran (fig. 1).
L'option 6 donne une représentation de la surface piézométrique de la nappe
en trois dimensions. Une flèche déplaçable permet d'obtenir des profils suivant
les lignes du maillage (fig. 5).
MODELE :
M0SELLE1
FICHIER :
ETEAP2
Fig. 5.- Blocs-diagrammes de la nappe de Loisy en été, en présence d'un puits
de pompage. Le fichier ETE1P33 fait appel à un maillage plus fin que le fichier
ETEAP2. Il exprime une détermination plus précise de la chute de potentiel
hydraulique liée au rabattement de la nappe autour du puits.
La Moselle constitue les limites occidentale et septentrionale du domaine
étudié, de potentiel connu. La simulation de l'influence d'un petit barrage sur
la Moselle montre, pour les deux fichiers correspondant à deux implantations
différentes, une chute du potentiel à l'emplacement du barrage. Les niveaux
piézométriques s'exprimant par une différence de hauteur d'eau, ils peuvent
être repérés par rapport au niveau de la mer (fichier ETEAP2) ou par rapport à
un niveau de base local (ici, la Moselle : fichier : ETE1P33).
Si le menu porte sur un barrage, l'option 6 -option SÉCURITÉ D U B A R R A G E donne accès à une représentation graphique du polygone des forces ou des
lignes de force ou encore des résultantes des forces qui s'exercent sur l'ouvrage
(fig. 6).
Poussée
Poids
Sous
du
1* e a u
2450
Tonnes
barrage
4125
Tonnes
658
Tonnes
de
pression
COEFFICIENT
DE
SECURITE
1 . 67
Fig. 6.- Résultantes des forces qui s'exercent sur un barrage-poids : le poids,
la poussée sur le parement amont et les forces de sous-pression à la base de
l'ouvrage.
L'option 7 donne accès à H Y D R O M O D si la capacité mémoire de l'ordinateur
est suffisante. Après une simulation dans des conditions hydrodynamiques
nouvelles, il faut sauvegarder le modèle actif afin de pouvoir l'afficher dans
HYDROS.
Outre l'entrée des conditions hydrodynamiques et la sauvegarde du modèle
actif, le menu d'HYDROMOD permet de lancer une simulation pour calculer les
nouveaux potentiels et pour visualiser les effets des conditions nouvelles. Un
sous-menu permet d'indiquer le nombre d'itérations à effectuer et la précision
souhaitée pour les calculs. Une option vérification de l'état du modèle assure
l'affichage des valeurs hydrodynamiques calculées pour chacun des points du
modèle. Il est aussi possible de faire afficher les lignes équipotentielles en
consultant la piézométrie du modèle actif.
Accessibles par l'option 8, les utilitaires, permettent, à l'aide de sous-menus,
de créer ou de modifier les pages d'informations sur les différents fichiers de
travail et de créer ou de modifier le dessin de barrages correspondant à des
conditions hydrodynamiques nouvelles.
UTILITAIRES
CRÉER UN DESSIN SIMPLIFIÉ DU BARRAGE
UTILISER LE DESSIN D'UN AUTRE BARRAGE
MODIFIER LE DESSIN DU BARRAGE
SAUVEGARDER LE DESSIN DU BARRAGE
VOIR LE DESSIN D U BARRAGE
CRÉER/MODIFIER LA PAGE D'INFORMATION
ABANDONNER LES UTILITAIRES
C. Création
scolaire
d ' É C O L'EAU,
un outil spécialisé adapté au milieu
Entièrement développé à des fins pédagogiques à partir d'études de nature
professionnelles, le logiciel donne une représentation schématique des
phénomènes qui participent au fonctionnement des nappes d'eau.
1. Définition du modèle
ECO L'EAU modélise l'enchaînement des phénomènes, depuis l'arrivée des
précipitations sur le sol jusqu'à la sortie de l'eau par les sources.
a. Les éléments pris en compte par le modèle sont significatifs des principaux
phénomènes :
- le ruissellement de l'eau à la surface du sol et les écoulements dans la partie
superficielle du terrain,
- l'évaporation d'une partie de l'eau de surface ou de la partie superficielle du
terrain,
-l'accumulation dans l'aquifère de l'eau qui a traversé la partie superficielle
du terrain,
- la vidange, à la base de l'aquifère, de l'eau des nappes par l'effet drainant
des sources.
Un certain nombre de lois simples permettent de caractériser les phénomènes
pris en compte dans le modèle :
- la loi qui donne les retards avec lesquels l'eau tombée sur le sol entre dans
l'aquifère en alimentant la nappe,
- la loi qui déduit l'évapotranspiration potentielle de la température de l'air au
jour considéré et aux jours précédents,
- la loi d'action des sources qui exprime la proportionnalité du débit des
sources à la hauteur d'eau de la nappe au dessus des sources,
- les retards sont déterminés empiriquement par comparaison des
précipitations et des variations concomitantes mesurées du niveau
piézométrique. L'ajustement de la répartition des retard fait appel à la méthode
statistique dite des moindres carrés.
- l'évapotranspiration est calculée à partir de la température de l'air.
Le débit des sources fait intervenir le coefficient de proportionnalité entre la
baisse du niveau piézométrique par unité de temps et la hauteur de la nappe au
dessus du niveau des sources. Ce coefficient est déterminé de façon empirique
par la méthode des moindres carrés, en comparant les baisses du niveau
piézométrique en fonction de la hauteur d'eau au dessus des sources en période
estivale, c'est à dire lorsque les précipitations n'atteignent pas la nappe. La
quantité d'eau que les premiers mètres du terrain peuvent retenir et qui est
soumise à l'évapotranspiration est un autre paramètre pris en compte. On
l'obtient en comparant les quantités d'eau des précipitations à celles qui entrent
effectivement dans la nappe et qui sont évacuées par les sources.
b. Le modèle créé fait appel à deux modes de représentation des phénomènes :
- la représentation d'un modèle hydraulique traduit les lois d'écoulement par
une animation à l'écran des mouvements de l'eau entre différents réservoirs
reliés par des tuyaux selon une séquence construite :
- sortie, par évapotranspiration, d'eau des réserves facilement utilisables du
sol,
- entrée, dans les réserves facilement utilisables, de l'eau qui provient des
précipitations du jour considéré (précipitations instantanées) et des jours
précédents (précipitations retardées),
- écoulement vers la nappe d'une partie de l'eau des réserves facilement
utilisables, si celles-ci sont saturées,
- écoulement de l'eau de la nappe vers les sources.
Cette représentation constitue une approximation provisoire favorable à la
compréhension des phénomènes.
- la représentation des résultats d'un modèle numérique, affichés sous forme
graphique en fonction du temps, montre les variations journalières du niveau
de remplissage des différents réservoirs. Ayant recours aux lois mathématiques
simples qui régissent les écoulements entre les réservoirs, le modèle prend en
compte le débordement des réserves facilement utilisables, cause des pluies
efficaces aux- quelles il applique la loi des retards.
c. L'algorithme du modèle numérique se résume par une succession de
calculs :
- calcul de l'évapotranspiration journalière, déduite des mesures de
températures sur de très nombreuses années,
- calcul des précipitations efficaces journalières :
Soit RFU, exprimée en millimètres d'eau, la quantité d'eau maximale que le
sol peut retenir et qui est susceptible de retourner à l'atmosphère.
Si RUi est la quantité effectivement retenue au début du jour considéré, RUj,
en fin de journée, après effet de l'évapotranspiration, est telle que
RUj = RUi - ETP si RUi > ETP. Dans le cas contraire, RUj = 0.
Après l'arrivée des précipitations P du jour, les réserves de fin de journée
devraient s'exprimer par RUf = RUj + P
Si RUf dépasse la valeur maximale RFU des réserves en eau utile, la capacité
d'absorption de la zone capillaire est dépassée et un écoulement se produit vers
la nappe : ce sont les précipitations efficaces PE ; sinon il n'a pas lieu :
. si RUf > RFU, alors PE = RUf - RFU et RUi = RFU (les réserves sont
saturées)
. si RUf < RFU, alors PE = 0 et RUi = RUf (les réserves restent inchangées).
- calcul des entrées d'eau dans la nappe :
Soient pO, p l , p2, p3,... pn les parts d'une pluie efficace PE arrivant dans la
nappe avec un retard de 1, 2, 3 , . . . n jours et PEO, PEl, PE2, PE3,... PEn, les
pluies efficaces du jour considéré, du jour précédent, de 2, 3 , . . . n jours
antérieurs, la quantité d'eau PA qui arrive à la nappe du fait des retards est :
PA = (PEO x pO) + (PEl x pl) + (PE2 x p2) + (PE3 x p3) + ... + (PEn x pn).
- calcul du niveau piézométrique après arrivée de l'eau :
Soit NPi le niveau piézométrique en début de journée. Après arrivée de l'eau
PA, le niveau, en fin de journée, devient NPj = NPi + PA.
- calcul du niveau piézométrique après effet des sources :
Soient Ho l'altitude des sources, k le coefficient de proportionnalité entre la
baisse journalière du niveau piézométrique et la hauteur d'eau au dessus des
sources.
La hauteur d'eau au dessus des sources est NPf - Ho
La baisse de la nappe dans la journée est DNP= (NPj - Ho) x k
Le niveau piézométrique s'établit en fin de journée à NPf = NPj - DNP
Ainsi, la liaison entre les précipitations et le niveau piézométrique n'est pas
directe, la relation directe s'établit entre les précipitations et la variation de
niveau piézométrique correspondante. Il en est de même pour les réserves
utiles. On ne peut calculer le niveau piézométrique et les réserves utiles en fin
de journée que si l'on connaît les valeurs correspondantes en début de journée.
Les calculs ne peuvent donc démarrer qu'à partir d'une date dont les niveaux
piézométriques et les réserves utiles sont connus, c'est à dire un jour où le
niveau piézométrique a été enregistré et qu'après de fortes pluies d'hiver les
réserves utiles sont voisines des réserves facilement utilisables RFU ou qu'après
une période très sèche de l'été, les réserves utiles sont très probablement nulles.
ECO L'EAU est un modèle différentiel.
d. Limites de validité du modèle dans diverses conditions hydrogéologiques :
Le modèle mis au point doit son intérêt pédagogique à l'aquifère de petite
taille, aux limites bien connues et dans lequel les phénomènes décrits
apparaissent avec des ordres de grandeur voisins.
Il possède cependant une portée générale du fait de sa définition peu
restrictive. C'est pourquoi on pourrait envisager de l'appliquer à des situations
variées :
- à des bassins versants de tailles très différentes, en modifiant la loi des
retards : ceux-ci sont d'autant plus grands que le bassin versant est plus grand,
- à des bassins de nature différente : plus les pentes sont fortes, le bassin
étanche et la végétation rare, plus les retards sont faibles,
- à des climats très différents, par une modulation en amplitude et en phase de
la fonction pratiquement sinusoïdale de l'évapotranspiration en fonction du
temps,
- à des capacités de drainage de la nappe très différentes suivant la
perméabilité de l'aquifère et l'étendue de l'intersection, à l'aval, de la nappe et
de la surface topographique.
La modélisation d'une nappe en pays karstique peut constituer un exemple
limite des écoulements de surface très rapides, avec une capacité de rétention
du sol très faible et un débit des sources qui ne répond plus exactement à la loi
de proportionnalité mais dépend directement de la répartition des circuits
karstiques.
La modélisation d'une nappe alluviale de fleuve en un point particulier du
cours représente un autre cas limite tel que, dans ECO L'EAU, la nappe ne
serait pas seulement alimentée par les précipitations locales mais aussi par la
nappe à l'amont et que la sortie de l'eau ne se ferait pas par des sources mais
par l'écoulement de la nappe vers l'aval.
La connaissance des caractéristiques hydrogéologiques n'a pas ici
l'importance qu'elle a pour H Y D R O S . ECO L'EAU n'a pas recours aux lois
physiques théoriques qui régissent l'écoulement de l'eau dans un milieu
perméable. Il ne fait pas appel aux mesures de perméabilité du terrain et de
rugosité de la surface du sol, propriétés qui déterminent l'écoulement de l'eau.
Il nécessite en revanche la connaissance des lois empiriques qui permettent de
déterminer l'évapotranspiration potentielle et les caractéristiques globales des
systèmes hydrauliques : part des précipitations arrivées avec retard, quantité
d'eau retenue dans la partie superficielle du terrain, quantité d'eau rejetée par
les sources en fonction de la hauteur d'eau. Chaque cas particulier impose un
calcul d'ajustement aux mesures indispensables du niveau piézométrique.
e. Caractères des données
Les données utilisées par le logiciel comprennent, pour la période 1974-1978
préalable aux travaux d'E.D.F., la date, la pluviométrie quotidiennement
enregistrée sur le site ou reconstituée à partir des stations voisines dans les
rares cas de panne de la station du site, la température journalière moyenne
(moyenne des valeurs maximale et minimale du jour), les niveaux
piézométriques donnés chaque semaine par quatre piézomètres.
Ainsi, ECO L'EAU est un modèle empirique dont les éléments donnent des
phénomènes une représentation physique proche de la nature, sans référence
aux lois de la physique. Il fait appel à des calculs nombreux mais simples. En
résumé les deux modèles H Y D R O S et ECO L'EAU se complètent pour exploiter
une démarche successivement physico-mathématique et naturaliste.
2. Structuration pédagogique d'ÉCO L'EAU
Écrit pour faire comprendre le fonctionnement d'une nappe d'eau, le scénario
initial d'ÉCO L ' E A U prévoyait une construction en deux parties : l'une
analytique, l'autre de simulation.
a. L'analyse a pour objectif la prise de conscience des facteurs qui régissent
une nappe d'eau. Elle porte sur les éléments d'une banque de données
piézométriques et climatiques, constituée par E . D . F . en prévision de
l'exploitation hydroélectrique du site aujourd'hui occupé par la retenue
dtAllevard, au nord-est de Grenoble.
Les informations sont accessibles par un choix de période (fig. 7).
Fl - Ou» f a i r » 7
F2 - C o — • n t a i r + s
Echap -
Sorti»
Fig. 7.- Représentation
graphique donnant accès à la détermination
l'influence des précipitations sur le niveau supérieur de la nappe.
de
La superposition des deux graphiques et le déplacement possible de l'un par
rapport à l'autre assurent la mesure du retard moyen de la montée consécutive
à l'arrivée des précipitations. Pour rendre l'analyse plus précise,
l'utilisateur
peut appeler des repères sous la forme de traits verticaux.
La recherche de l'influence des précipitations suivant les saisons s'illustre de
courbes dont la pente renseigne sur leur efficacité (fig. 8).
U a r i a t i o n du niveau piézométrique de P3 e n t r e 2 mesures consécutives <m)
60
* Hiver
o Eté
80
100
P r é c i p i t a t i o n s e n t r e 2 mesures <mm>
La d r o i t e a c t u e l l e c a r a c t é r i s e r a i t une i n f l u e n c e des p r é c i p i t a t i o n s t e l l e que :
1 mm de p r é c i p i t a t i o n s f a i t monter l a nappe de
FI - Que f a i r e ?
F2 - Commentaires
Echap -
0.0 millimètre
Sortie
Fig. 8.- Représentation
graphique de la relation entre précipitations
et
variations du niveau piézométrique : les précipitations efficaces font monter la
nappe en hiver, elles sont nulles en été.
Les précipitations efficaces se déduisent aussi, indirectement, de l'étude
graphique des modalités de vidange de l'aquifère, confrontée au modèle d'un
réservoir percé : ce n'est qu'en l'absence de précipitations efficace, qui
s'opposent à la baisse du niveau supérieur de la nappe, que l'aquifère se vide
comme un réservoir percé non alimenté.
En autorisant la translation de la courbe de vidange théorique du réservoir, le
logiciel permet de déterminer h s périodes de coïncidence avec la baisse du
niveau piézométrique, autrement dit les périodes où, l'eau tombée n'entrant pas
dans la nappe, le débit des sources n'est pas compensé (fig. 12).
b. La simulation du fonctionnement de la nappe permet à l'utilisateur de
contrôler les facteurs de variation du niveau piézométrique. Cette phase
quantitative exploite un modèle mathématique inaccessible dans le temps
scolaire. Pour l'enseignement apparaît la nécessité de définir ce modèle
complexe par une représentation schématique qui facilite au départ la mise en
relation conceptuelle des facteurs dégagés de l'analyse et susceptibles
d'intervenir dans la simulation. La visualisation de la dynamique de la nappe,
sous forme d'un schéma fonctionnel hydraulique animé, prépare l'ancrage des
déductions de l'élève en phase de simulation (fig. 9).
PRECIP.
Précipitations <•
EUAPOR.
U
E v a p o t r a n s p i r a t i o n p o t e n t i e l l e <im)
t
200.
100.
Réserves facilement
300.
200_
RESERUES
FACILEM.
UTILISAB.
utilisables
9|
14
lOi
(n)
d i l in i i . i l l
3J
Niveau d e l a nappe
4|
<mm>
6J
H
Hauteur
^
^
9|
7
P é r i o d e n * 13
700.
Précipitations
600.
Evapotransp.
400.
200.
100.
0_
i
11
12
d ' e a u é v a c u é e p a r l e s s o u r c e s (mm)
800.
300.
ÎOJ
A vous d e jouer
900.
500.
12
11
12f
I —
mm
01
pot.
0
J
Fig. 9.- Modèle mettant en évidence l'influence des différents facteurs de
variation du niveau supérieur d'une nappe : cinq boites reçoivent les
précipitations, l'évapotranspiration, les réserves facilement utilisables, l'eau de
la nappe et l'eau des sources. Un bilan a lieu, mois par mois, qui peut être
prolongé par l'utilisateur, au gré de ses données ou de ses hypothèses.
A l'opposé de ce modèle simple et imagé, le modèle mathématique,
typiquement professionnel, est la boite noire qui calcule et permet de prévoir.
Figuré pour l'élève sous forme de courbes, il devient explicite, et rend alors
possible la confirmation ou l'invalidation du modèle en cours d'élaboration
(fig. 10).
60
1 P r f ç j p i t a t j o n s <MA>
— Évapotranspiration potentielle
40
20
0
1L
ii..
,ikIHtl 11 il L1 .iilil .,il.lin. j l,
m
Ë
1
I
m
Taux de s a t u r a t i o n des reserres
80
60
40
20
0
1
1
u t i l e s </Q
Njv«+u* P K r i g w f t r j q u e s <•>>
— C+Jwlg
* observe
Débit des sources <»etres cubes/heure?
1974
Fig. 10.- Représentation graphique des données corrélées dans le modèle
mathématique. Tant que le niveau piézométrique calculé ne se superpose pas au
niveau piézométrique observé, le modèle n'est pas calé.
Plusieurs caractéristiques d'ÉCO L'EAU donnent plus de liberté et d'autonomie
à l'utilisateur : l'accès au menu depuis les différents thèmes, les fonctions d'aide
(Fl) et de commentaires (F2), le dictionnaire (F3), l'accès direct à la définition
des mots écrits en capitales dans l'aide et dans les commentaires (F4).
La volonté d'exploiter des modèles professionnels implique qu'ils s'ajustent
rigoureusement
au réel. Le choix d'un modèle à simple valeur didactique
offrant un accès facile et concret -probablement simpliste- à l'explication des
phénomènes ne permettrait pas d'atteindre l'objectif qui est de motiver les
élèves par une mise en situation proche de celle d'un vécu professionnel.
En effet, celui-ci est toujours confronté à des problèmes concrets :
approvisionner en eau des aciéries, irriguer un champ de maïs ou drainer la
nappe d'un talus destiné à optimiser, en toute sécurité, la capacité d'une retenue
(fig. H ) .
60
40
20
0
i
1 1 1
m i t 1 b,Jl L U i l
i\
u'Ji Jbl
1
, IJJ
„i
, 1 1 II ibkLl
1
l.l,
i
y
ii il
ulvu
Evapotranspiration potentielle («m)
Taux de saturation des réserves utiles CV.)
1
W
Niveaux piézométriques (m)
3
- calcule
—• enregistre
Mise en service des drains
Fig. 11.- Simulation
montrant l'impact d'un drainage sur le niveau
piézométrique.
La validation du modèle passe par son ajustement
aux
contraintes du réel.
Fig. 12.- Représentation des variations du niveau piézométrique,
sur une
période choisie de trois ans, comparée au modèle graphique de vidange d'un
réservoir percé.
En translatant la courbe de vidange, l'utilisateur détermine les périodes de
coïncidence durant lesquelles la nappe n'est pas alimentée par les précipitations
efficaces. L'aquifère se comporte alors comme un réservoir percé.
Pour HYDROS et pour ECO L'EAU, un seul exemple géographique introduit le
modèle. Le premier permet de saisir de nouvelles données pour de nouvelles
simulations. Mais celles-ci doivent rester dans le cadre physique du problème
hydrogéologique posé. Pour le second, le transfert à de nouveaux environnements serait possible à la condition nécessaire mais non suffisante de disposer
de données nombreuses sur les sites. La recherche appliquée en milieu
professionnel montre que si des mesures continues, forcément coûteuses,
existent dans les zones à risques, elles manquent en l'absence de projet précis
d'aménagement, et qu'un modèle est d'autant plus exactement ajusté au réel que
les enjeux économiques et humains sont plus grands. La complexité des
interdépendances entre les différents paramètres fait que chaque nouveau réel
appelle un remaniement du modèle.
En résumé, pour les deux logiciels utilisés, la transposition devait faciliter les
apprentissages scientifiques sans introduire d'inutiles difficultés d'ordre
informatique. L'ordinateur rend favorable l'exploitation pédagogique en
autonomie des logiciels adaptés à condition d'être rapide, avec écran couleur de
haute résolution et de servir dans le cadre de véritables travaux pratiques en
petits groupes. Longue et progressive, la transformation a consisté à mettre les
produits en conformité avec le matériel -les matériels- de l'Education nationale
et surtout à opérer les modifications successives d'ordre pédagogique,
susceptibles d'améliorer l'appropriation des concepts. Grâce aux
représentations graphiques conventionnelles que l'élève doit sans cesse
confronter à ses propres conceptions, l'ordinateur facilite l'approche
individuelle des nappes d'eau, objets réels complexes à dynamique
multifactorielle. C'est surtout cette visualisation des phénomènes qui distingue
les deux produits expérimentés des véritables logiciels professionnels où la
précision des résultats des calculs prime sur leur lisibilité.
En dépit des contraintes qu'impose le transfert à la classe des logiciels professionnels, leur emploi s'avère riche de promesses car il donne accès à une
démarche scientifique très complète. En ouvrant la géologie aux autres sciences
et en entraînant les élèves au raisonnement déductif, ceci plaide en faveur d'un
enseignement de la géologie qui garde un ancrage dans le réel complexe tout en
facilitant une indispensable exploitation rationnelle des modèles.
Le menu et les principales fonctions d'ÉCO L'EAU.
A : FAIRE CONNAISSANCE
Données sur le site
A l . Données de terrain et cartographiques : nappe souterraine d'Allevard
A2. Données climatiques et piézométriques : choix d'une période d'étude
A3. Représentation graphique des données pour la période d'étudier
B : OBSERVER POUR COMPRENDRE LES NAPPES
Recherche des facteurs de variation des nappes
naturelles
B l . Influence des précipitations
B2. Influence de la saison
B3. Influence des sources
C : CONSTRUIRE UN MODÈLE POUR REPRÉSENTER LES NAPPES
Explication
et représentation
du fonctionnement
des nappes
B l . Type de modèle et composants du modèle : choix du modèle
B2. Représentation du modèle hydraulique
B3. Représentation du modèle mathématique confronté au réel
D : SIMULER POUR PRÉVOIR L'IMPACT DE TRAVAUX SUR LES NAPPES
Exploitation
du modèle pour prévenir
des risques
D l . Prévision de l'impact d'un pompage industriel
D2. Prévision de l'impact d'un pompage pour irrigation
D3. Contrôle de l'efficacité de travaux de drainage
III. APPLICATION PÉDAGOGIQUE DES OUTILS ADAPTÉS
L'étude expérimentale de l'utilisation des logiciels a eu lieu au Lycée Bichat
de Lunéville et au Lycée Callot de Vandœuvre pour H Y D R O S , au Lycée Jeanne
d'Arc de Nancy et au Lycée Callot de Vandœuvre puis au lycée Henri Poincaré
pour ECO L'EAU.
A.Utilisation du logiciel HYDROS pour comprendre et représenter
dans l'espace la dynamique d'une nappe
Le syndicat intercommunal de Loisy exploite l'eau de la nappe alluviale de la
Moselle pour la consommation humaine (A.E.P. : Adduction d'Eau Potable).
Le logiciel H Y D R O S donne accès à une simulation cartographique des
isopièzes qui permettent de prédire les effets des modifications de certaines
conditions hydrodynamiques ; il devient possible d'agir pour assurer une
protection et une gestion de cette ressource en eaux souterraines. Cependant, le
professionnel doit confronter en permanence les résultats obtenus aux résultats
constatés sur le terrain. L'emploi du logiciel au lycée place donc l'élève dans
des situations réelles concrètes, étendant à la classe la résolution de problèmes
d'hydrogéologie : écoulement de l'eau d'une nappe alluviale, surveillance et
protection de la nappe en exploitation.
1. Activités des élèves
- Prérequis : concepts de roche sédimentaire, d'aquifère, de porosité et de
perméabilité, lecture d'une carte et d'un profil topographique, d'une carte et
d'une coupe géologiques simples.
- Matériels : alluvions de la Moselle, roches argileuses de la vallée de la
Moselle et calcaires de la Côte de Moselle, photographie aérienne du site, carte
topographique de Pont-à-Mousson à 1/25000 et carte géologique
correspondante agrandie à 1/25000.
- Vocabulaire et mots-clés : potentiel hydraulique, surface piézométrique,
niveau piézométrique, ligne isopièze ou ligne équipotentielle, lignes de courant,
rabattement d'une nappe, périmètre de protection de la nappe.
a. Comprendre le fonctionnement d'une nappe d'eau : écoulement de l'eau de
la nappe.
La présentation géographique et géologique du site à l'aide des outils
traditionnels du géologue permet de préciser, sur un profil piézométrique
suivant XX', l'acquis conceptuel concernant la relation des eaux de surface et
de la nappe avec, en particulier, sur un profil piézométrique suivant YY', le
sens d'écoulement de l'eau de la nappe en l'absence de pompage. Elle pose
clairement les problèmes liés aux ouvrages existants, ou en projet : présence
d'une station de pompage repérée sur la carte par l'intersection de XX' et YY',
implantation d'un barrage destiné à régulariser le débit de la rivière à l'amont
d'une centrale thermique, tracé d'une autoroute,... (fig. 13).
Le travail sur ordinateur requiert de l'élève un réinvestissement des prérequis
conceptuels et méthodologiques et l'utilisation des informations obtenues à
l'aide des documents bruts et élaborés de terrain.
N
500m
Fig. 13.- Carte topographique faisant apparaître, en P, la station de pompage
située dans la boucle formée par l'Obrion, le canal et la Moselle.
Elle montre aussi, au Nord, la centrale électrique de Blénod les
Mouson et, de direction nord-sud, l'autoroute A31 déjà construite.
Pont-à-
Le programme comporte plusieurs fichiers préconstitués correspondant à des
situations réelles de la nappe, avec et sans pompage, en été et en hiver.
Nappe non exploitée :
- l'élève choisit un fichier de nappe non exploitée, en été par exemple,
- il demande le tracé du bloc-diagramme de la surface piézométrique de la
nappe par l'ordinateur,
- il fait réaliser par le logiciel divers profils de la surface piézométrique
repérés sur le bloc-diagramme (fig. 5),
- l'analyse de ces profils l'amène à préciser la relation entre surface
piézométrique et niveau de l'eau dans la rivière,
- il demande l'affichage des lignes équipotentielles (fig. 14 : fichier 2ETESP2).
Le graphique obtenu renseigne sur les niveaux piézométriques ou potentiels
hydrauliques (en abrégé POT.),
MODELE :
M0SELLE2
FICHIER :
2ETESP2
MODELE :
M0SELLE2
FICHIER :
2ETEAP2C
EQUIDISTANCE
0.050
E
D
EQUIDISTANCE
0.078
F
D
E
F
178.83
4-x179.22
179.61
B
500m
A
'180.00
B
500m
A
'180.00
Fig. 14.- Cartes des isopièzes obtenues par simulation de l'écoulement de l'eau
de la nappe de Loisy en l'absence et en présence d'un pompage.
- sur les indications de l'enseignant, il trace à l'écran diverses lignes
hypothétiques d'écoulement d'eau à partir de différents points de la nappe ; la
correction de ce tracé peut être effectuée par l'ordinateur. Les différentes
lignes de courant ainsi visualisées donnent une idée précise de la dynamique
spatiale de la nappe (fig. 1).
De cette séquence se dégage une règle : dans un aquifère isotrope, l'eau de la
nappe s'écoule perpendiculairement aux isopièzes, des potentiels hydrauliques
les plus élevés vers les potentiels les plus bas. En suivant pour un fichier
hivernal la même démarche que pour le fichier estival initialement choisi, on
introduit, par comparaison, la dynamique temporelle de la nappe ce qui
favorise la généralisation de son fonctionnement.
Nappe en exploitation :
- l'élève choisit un fichier de nappe exploitée, en été (fig. 14 : fichier
ou en hiver, pour obtenir le tracé des lignes équipotentielles et des
lignes de courant d'eau. Par comparaison avec les cartes obtenues en l'absence
de pompage, il déduit l'influence du pompage sur l'écoulement de l'eau ; il peut
déterminer le lieu des points tels que l'eau de la nappe s'écoule vers le puits à la
saison considérée.
2ETEAP2C),
De cette séquence se dégage la notion de rabattement de nappe.
Par ses activités dans l'environnement de la nappe et par l'exploitation de la
réserve qu'elle constitue, l'Homme modifie la qualité de l'eau et la quantité
disponible. La séquence suivante introduit le problème de surveillance de la
nappe à des fins de gestion et de protection : à l'aide des cartes réalisées par
l'ordinateur, l'élève doit répondre à ces deux objectifs du Syndicat
d'exploitation des eaux de Loisy.
b. Sauvegarder la qualité de l'eau : prévention des risques de pollution dûs à
un accident routier.
- l'élève trace, sur la carte d'isopièzes obtenue par un fichier avec pompage
(fig. 15 : fichier 2ETEAP2C), les lignes de courant qui montrent dans quelles
conditions un polluant déversé sur l'autoroute A31 peut atteindre le puits,
- il déduit du tracé la portion d'autoroute présentant des risques pour la
station,
- il trace les limites de la zone de protection à aménager le long de l'autoroute
pour sauvegarder la qualité de l'eau de pompage,
- en comparant les cartes d'isopièzes obtenues à différentes saisons, il propose
un nouveau tracé pour l'autoroute.
La représentation de l'autoroute et/ou de ses rives fait appel à la fonction
<tracé manuel> des lignes de courant, comme pour le périmètre de sécurité
devant assurer la protection des puits dans des conditions variées (pompage à
divers débits... ).
MODELE :
MODELE
M0SELLE2
POT.
FICHIER : 2ETEAP2C
177.66
POT
MOSELLE
POT.
MIN
MAX
FICHIER : 2ETEAPE
MIN
174.17
POT.
MAX
180.00
180.00
EQUIDISTANCE
EQUIDISTANCE
0.078
0.194
X-H+
179.03
A31
A31
Fig. 15.- Cartes des isopièzes obtenues par simulation de l'écoulement de l'eau
de la nappe, montrant le rabattement accru quand le débit du pompage
augmente.
c. Gérer la ressource en eau : répondre à des besoins en augmentation
Pour répondre à une demande croissante, le syndicat intercommunal de Loisy
prévoit d'augmenter le débit du pompage ou de forer un nouveau puits dans la
nappe en exploitation. Il veut connaître à l'avance les conséquences de ces
actions sur le niveau piézométrique et sur les risques de pollution. Il
s'interroge également sur l'incidence d'un étiage de la Moselle.
- Pour prévoir l'effet d'une augmentation du débit de pompage, l'élève
appelle un fichier correspondant à cette hypothèse (fig. 15 : fichier 2ETEAPE).
En opérant comme précédemment, il visualise la surface piézométrique, fait
apparaître le rabattement de la nappe, d'autant plus important que le débit est
plus grand, et il reconsidère le tracé de l'autoroute à la lumière des nouvelles
lignes de courant.
- Pour déterminer l'effet d'une baisse de niveau de la Moselle, l'élève
demande l'accès à H Y D R O M O D afin de changer les conditions -les potentiels
hydrauliques- aux limites puis d'observer la nouvelle carte des isopièzes,
- Il peut de la même façon imposer d'autres changements aux caractéristiques
du modèle (débits unitaires dûs aux apports par les pluies, débits linéaires dûs
aux apports latéraux des coteaux calcaires, débits ponctuels d'un ou de
plusieurs pompages supplémentaires...) pour créer de nouvelles simulations
(fig. 4).
Une conclusion s'impose : la protection et la gestion d'une réserve d'eau
souterraine doit prendre en compte l'ensemble des facteurs qui influent sur la
qualité et la quantité de l'eau disponible : propriétés de l'aquifère (dimensions,
porosité et perméabilité), conditions hydrodynamiques aux limites, conditions
climatiques, interventions humaines (débits de pompage, périmètres de
protection...).
d. Connaître l'écoulement de l'eau sous un barrage : en prévenir les
conséquences
Les fichiers de barrage disponibles ont été obtenus à partir de l'exemple alpin
de Bissorte, construit en Maurienne au niveau d'un verrou glaciaire, sur des
formations résistantes, conglomératiques présentant une grande perméabilité
de structure. Ce matériau de fondation du barrage constitue l'aquifère dont le
professionnel a déterminé préalablement les caractéristiques hydrodynamiques
en fonction des paramètres de l'ouvrage en projet. Mis dans la situation
professionnelle préalable à la construction du barrage, l'élève doit prévoir les
solutions économiquement favorables à sa sécurité au renversement.
Écoulement de l'eau sous un barrage-poids :
- l'élève obtient le tracé des lignes équipotentielles et des lignes de courant du
domaine sous barrage,
- afin d'évaluer la stabilité de l'ouvrage, il représente, à l'aide de l'ordinateur,
les différentes forces qui s'exercent sur le barrage-poids,
- il concrétise l'écoulement sous-barrage et, pour chaque ligne isopièze, il
déduit du niveau piézométrique en mètres d'eau (de 70 à l'amont à 0 vers
l'aval), la hauteur à laquelle l'eau monterait si un piézomètre l'atteignait à la
base de l'ouvrage (fig. 16).
MODELE :
50
MODELE :
BARRAGE
A5
Âo
tS
30
BARRAGE
FICHIER :
15
NYB3
20
FICHIER :
NYB3C4
POT. MIN
0.00
Fig. 16.- Page de classeur d'élève simulant la mise en place d'un voile de
béton sous le barrage, pour accroître son coefficient de sécurité au
renversement.
L'eau exerce sous le barrage des forces qui tendent à le renverser, de moins
en moins fortement de l'amont vers l'aval de la base de l'ouvrage. C'est ce qui
explique la section triangulaire du barrage-poids. Pour stabiliser l'ouvrage en
réduisant plus rapidement à l'amont les forces de sous-pression, le
professionnel intervient par des voiles de drainage et/ou d'étanchéité de
perméabilité plus ou moins grande, aux effets hydrauliques comparables à
ceux offerts respectivement par une faille très étanche ou une faille ouverte.
Augmentation de la stabilité du barrage :
- Après avoir fait déterminer par l'ordinateur le coefficient de sécurité du
barrage en l'absence de voile, l'élève simule le détournement favorable des
lignes de courant par un voile d'étanchéité : pour voir l'influence de la
fondation sur les écoulements souterrains donc sur la sécurité de l'ouvrage, il
peut faire appel à différents fichiers pour lesquels a été simulée l'influence de
voiles d'étanchéité et/ou de drainage différant par leur emplacement sous le
barrage, leur profondeur dans le domaine sous barrage et leur perméabilité.
- L'élève peut être invité à accéder à H Y D R O M O D pour modifier lui-même
localement la perméabilité de l'aquifère en créant, par exemple, à un endroit
précis sous l'ouvrage, un voile d'injection de perméabilité dix fois, cent fois,
mille fois,... plus faible que celle de la roche située sous le barrage. En
désignant les nœuds extrêmes qui la caractérisent, il définit la fraction de grille
concernée par la modification du domaine sous barrage et lance les calculs.
Le fichier ainsi créé est sauvegardé, ce qui permet de le rappeler, d'examiner
à l'écran les lignes équipotentielles, de mettre en évidence, pas à pas ou en
mode automatique, l'écoulement de l'eau de l'amont vers l'aval dans l'aquifère
du domaine situé sous l'ouvrage et/ou de faire calculer par l'ordinateur la
nouvelle répartition des forces de sous-pression et le nouveau coefficient de
sécurité du barrage devenu nettement supérieur à 1.
- L'élève peut choisir de modifier d'autres conditions hydrodynamiques
(hauteur de la retenue, etc.) pour faire calculer par l'ordinateur l'influence du
poids de l'ouvrage, opposé à la poussée de l'eau à l'amont et aux pressions qui
s'exercent sous le barrage.
L'étude montre que la
déstabilisatrices, peuvent
d'eau de la retenue et en
voiles et un poids calculés
poussée de l'eau et les forces de sous-pression,
et doivent être contrôlées en maîtrisant la hauteur
agissant, dans la réalisation de l'ouvrage, par des
pour assurer la stabilité donc la sécurité du barrage.
2. Évaluation des résultats de l'expérimentation d'HYDROS en classe
L'expérimentation de la partie consacrée à la nappe alluviale de Loisy s'est
déroulée sur deux années scolaires, en 1990-1991 et en 1991-1992, pour
permettre d'adapter progressivement les produits aux objectifs modulés par les
réactions des élèves.
a. Expérimentation en classe de seconde
La première phase, en 1990-1991, a concerné deux classes d'une trentaine
d'élèves, dédoublées pour les travaux pratiques dans une salle équipée de deux
ordinateurs et d'un rétroprojecteur. Puisqu'une bonne compréhension des
modèles informatiques impose une approche claire et concrète des faits donc
l'utilisation préalable des outils traditionnels, les élèves disposaient de
documents d'accompagnement destinés à faciliter l'analyse préalable :
- une photographie aérienne et un plan de situation à 1/10 000 pour deux
élèves,
- une carte topographique à 1/25 000 du site pour chaque élève,
- une carte géologique agrandie à 1/25 000 pour deux élèves.
Des transparents pour rétroprojecteur de ces documents favorisent la mise en
commun et la correction des observations. Des tirages individuels, sur papier,
préparent la mise en relation du concret à l'abstrait, avec retour au concret :
des photocopies d'extraits de cartes, topographique et géologique, et des
reproductions de courbes isopièzes obtenues par simulation sur ordinateur
assurent le suivi et l'évaluation du travail personnel.
Pour chaque séquence intégrant un bref emploi de l'ordinateur, l'alternance
du travail sur matériel informatique et sur documents traditionnels manque de
confort. En dépit des conditions difficiles d'accès individuel aux ordinateurs,
révélatrices des différences d'appropriation entre les élèves plus ou moins
familiarisés avec l'informatique, des notions ont nettement bénéficié de
l'emploi du logiciel :
- l'écoulement de l'eau d'une nappe, par la représentation des lignes de
courant,
- le rabattement de la nappe, par l'obtention de profils de la nappe,
- les facteurs de variation du niveau piézométrique, par la comparaison des
lignes isopièzes obtenues par simulation dans des conditions différentes,
- l'impact de l'homme sur les nappes, par la prévision de l'incidence de ses
interventions sur la dynamique de l'eau.
Mais le passage des documents traditionnels au modèle sur ordinateur s'avère
trop brutal. Un schéma très abstrait à l'écran suffit au professionnel, le même
schéma, pourtant concrétisé, déroute les élèves. Une étape s'impose pour
expliquer le passage de la carte topographique à celle des isopièzes. Cette
première expérimentation entraîne des améliorations informatiques et
pédagogiques : H Y D R O S permet de superposer le maillage à la carte des
isopièzes. Interrogé, l'ordinateur trace les lignes de courant qui servent
d'autocontrôlé à la compréhension de la dynamique de la nappe et préparent le
retour aux documents traditionnels de l'évaluation finale.
Une carte topographique comportant le maillage du modèle permet de
surimposer les isopièzes aux limites géographiques : au lieu d'une approche
collective grâce au seul rétroprojecteur, elle assure la découverte individuelle
des points de convergence entre le dessin cartographique sur papier et le
schéma d'ordinateur à traduire sur le papier.
La deuxième phase de l'expérimentation a eu lieu l'année suivante, quand les
lycées s'équipaient d'une salle de travaux pratiques en partie dédiée aux
technologies nouvelles, cinq à huit postes permettant d'y travailler à deux ou
trois élèves par ordinateur. Elle a concerné à nouveau deux classes de seconde
d'une trentaine d'élèves et permet de préciser les apports de l'ordinateur dans
l'évaluation de la capacité à comprendre la dynamique d'une nappe alluviale.
Pour préciser les objectifs susceptibles d'être atteints au travers du logiciel
les deux classes participent ensemble à un protocole expérimental en
réalisant des exercices formatifs en parallèle pendant trois séquences de 50 à 55
minutes : une durée importante au regard de l'ampleur des programmes mais
difficile à comprimer en phase de recherche. Rarement aussi complète,
l'exploitation prendrait moins de temps en utilisation courante.
HYDROS,
Les deux classes X et Y approchent les problèmes par des exercices préalables
communs, sur documents géographiques et géologiques traditionnels. Ils
portent sur l'identification de l'aquifère, la représentation de la nappe et la
recherche d'une solution (un ou plusieurs puits ou piézomètres) pour vérifier
l'hypothèse du sens d'écoulement de l'eau de cette nappe. Les résultats de cette
première partie commune différent peu entre les deux classes (fig. 17).
Pourcentage de réussite
classe X
la. Identification de l'aquifère et/ou de la nappe
l b . Représentation correcte du niveau supérieur de la nappe
de plusieurs puits
100
100
75
70
20
30
(ldl)
40
50
(ld2)
60
50
l e . Matérialisation de l'épaisseur de la nappe
l d . Construction correcte d'un puits
classe Y
REPRÉSENTATION DANS L'ESPACE DE LA DYNAMIQUE D'UNE
NAPPE ALLUVIALE
POURCENTAGE DE RÉUSSITE POUR LA PARTIE COMMUNE SANS ORDINATEUR
1a
1b
1d1
1c
H
classe X B
1d2
classe Y
Exercices 1a à 1c :
identification de l'aquifère et
représentation correcte de la nappe
1d1 ou 1d2 : construction
d'un ou plusieurs puits
Fig. 17.- Performances de deux classes de seconde dans une évaluation de la
capa- cité à comprendre et à représenter dans l'espace la dynamique d'une
nappe alluviale.
Pour la partie commune faisant appel aux outils traditionnels du géologue
(exercices de la séquence 1) les résultats des deux classes diffèrent peu.
Les performances proches des deux classes, pour la partie commune des
exercices, autorisent une comparaison des résultats obtenus pour les deuxième
et troisième séquences, caractérisées par une approche différente des problèmes
à résoudre.
Au moment de cette étude en classe X, le lycée ne dispose que de trois
ordinateurs, utilisés seulement à la fin des premiers exercices pour l'évaluation
et la correction. Les élèves sont guidés dans leurs activités par les cartes
d'isopièzes obtenues par simulation sur ordinateur et tirées sur sur imprimante.
Peu après, la classe Y aborde les mêmes exercices directement sur ordinateur
dans la salle enfin équipée. Les pages-écran obtenues sont ensuite imprimées.
C'est le travail sur papier qui, dans les deux cas, sert à l'évaluation mais, dans
la classe X, celle-ci a lieu avant d'utiliser l'ordinateur, elle a lieu après dans la
classe Y. La correction pratique sur ordinateur apporte dans la classe X un
rattrapage tout en offrant aux élèves une satisfaction.
Pour la même durée des séquences deux et trois, les résultats des deux classes
diffèrent en qualité et en rapidité, les conditions les meilleures résidant dans la
recherche d'une solution aidée par l'ordinateur, tant pour la classe X, après une
première évaluation moins favorable en l'absence d'ordinateur, que pour la
classe Y qui utilise d'emblée l'ordinateur (fig. 18).
Les exercices de la deuxième séquence portent sur le tracé des lignes de
courant sur la carte des isopièzes en l'absence (2a) puis en présence (2b) d'un
pompage et sur la construction d'un résumé clair (2c) ; ceux de la troisième
séquence portent sur le tracé de la zone de vulnérabilité au regard de
l'autoroute en projet avant (3a) et après (3b) augmentation du débit de
pompage et sur la construction d'une conclusion structurée (3c). Seule la classe
Y trouve le temps de simuler une nouvelle situation d'urgence (4) en imposant,
grâce à H Y D R O M O D , des conditions hydrodynamiques nouvelles par des apports
latéraux, polluants, à la nappe de Loisy.
Pourcentage de réussite
classe X classe Y
Nappe non exploitée
2a.Tracé des lignes de courant sur la carte des isopièzes
(entre parenthèses : tracé après correction sur ordinateur)
Nappe en exploitation
2b.Tracé des lignes de courant sur la carte des isopièze
(entre parenthèses : tracé après correction sur ordinateur)
2c.Résumé écrit correct, réalisé grâce à un temps suffisant
3a.Tracé correct de la zone de vulnérabilité
3b.Nouveau tracé prenant en compte un débit accru
3c.Conclusion exprimant les solutions attendues
4. Nouvelle simulation réussie en 30 minutes à une heure
20 (100)
100
30 (100)
100
0
60
60
80
80
100
100
100
100
_2a
2b
B classe X avant
l'aide de l'ordinateur
2c
3a
B classe X aidée par 1 i
l'ordinateur
Exercices : 2a à 2b : tracé des lignes 2c : résumé
de courant
3b
3c
classe Y travaillant
sur ordinateur
3a à 3b : nouveau
tracé
3c : conclusion
Fig. 18.- Les apports de l'ordinateur, déduits des performances
de deux
classes de seconde dans une évaluation de la capacité à comprendre et à
représenter dans l'espace la dynamique d'une nappe alluviale.
Pour la partie distincte avec rattrapage sur ordinateur (exercices 2), les
résultats des deux classes diffèrent tant que la classe X n'utilise pas l'ordinateur
et le temps manque à cette classe pour le résumé individuel Pour la troisième
séquence sans rattrapage (exercices 3), les élèves de la classe X acquièrent la
méthode sans l'aide de l'ordinateur mais l'apprentissage est plus lent que pour la
classe Y travaillant sur ordinateur.
La troisième phase de rexpérimentation d'HYDROS en classe de seconde s'est
caractérisée par une collaboration des professeurs de biologie et géologie, de
sciences physiques et de mathématiques pour définir les concepts introduits par
le logiciel, outil mathématique mobilisant des notions de physique.
D'objectifs disciplinaires plus limités pour se conformer aux programmes,
l'évaluation sommative témoigne de progrès unanimes en une séquence d'une
heure et demie de travaux pratiques sur ordinateur.
Ces progrès portent sur la compréhension de la représentation graphique de
la surface piézométrique d'une nappe, sur le tracé par l'élève, des lignes de
courant, sur l'explication du rabattement de la nappe autour d'un puits en
pompage, sur la définition d'un périmètre de protection autour du puits dans
plusieurs situations polluantes, sur le test des hypothèses conçues par l'élève
pour dessiner une route en toute sécurité dans l'environnement de ce puits.
Les documents cartographiques d'accompagnement se révèlent à l'usage
encore trop élaborés pour l'étude préalable ; d'où la nécessité d'utiliser des
photographies aériennes du site avant les travaux et de réaliser de nouvelles
images mettant en évidence sur le terrain les caractéristiques de l'aquifère.
Le modèle
l'aquifère, ce
une étendue
signification
hydraulique.
informatique de rabattement de nappe fait abstraction de
qui risque de renforcer les conceptions des élèves qui imaginent
d'eau là où la nappe occupe un aquifère. Il prend sa véritable
si les élèves
expérimentent auparavant sur un modèle
Le modèle mathématique prolonge et précise le modèle physique, il ne le
remplace pas. Une séparation claire des trois étapes du professionnel offre les
perspectives les plus favorables à condition de bien définir les cadres successifs
de référence : formulation du problème à une échelle accessible, emploi de
modèles physiques et mathématiques, traduction en retour des résultats sur les
documents cartographiques de l'échelle de départ.
En résumé, la capacité à comprendre et à représenter la dynamique d'une
nappe alluviale est indispensable pour appréhender et résoudre les problèmes
de gestion et de pollution. Elle exige des apprentissages répétés et diversifiés de
la représentation des caractéristiques hydrodynamiques du site : niveaux
piézométriques, isopièzes et lignes de courant. L'utilisation de l'ordinateur
favorise cette acquisition grâce à deux avantages majeurs :
- il peut donner d'emblée les constructions graphiques souhaitées : dans ce
cas, la situation pédagogique est proche d'une situation d'application
professionnelle,
- ou bien il permet de multiplier les essais et de les corriger : dans ce cas, la
situation pédagogique contraint l'élève à utiliser ses acquis en appliquant des
conditions hydrodynamiques nouvelles pour tendre vers la solution de
problèmes de plus en plus complexes en adoptant la démarche du professionnel.
Dans les deux cas, l'ordinateur constitue un support privilégié des activités
pratiques de l'élève.
b. Expérimentation en classe de première B
Une expérimentation de la partie d'HYDROS destinée à simuler la circulation
de l'eau sous un barrage a eu lieu en 1990-1991 : une séquence pratique de
deux heures s'est déroulée dans les mêmes conditions que la première
expérimentation en classe de seconde, avec seulement deux ordinateurs.
Rapprochée des sciences physiques, elle aide les élèves à mieux dominer un
secteur dans lequel ils se sentaient peu à l'aise.
Les préacquis des activités sur ordinateur sont apportés par des travaux
pratiques sur documents traditionnels qui sensibilisent les élèves au problème
géologique dans son contexte économique, domaine de spécialisation de la
classe.
Le professionnel conclut avec des chiffres, les élèves visualisent leurs
résultats. C'est pourquoi H Y D R O S ne présente pas de difficultés majeures
d'utilisation :
- la comparaison des tracés individuels, manuels, avec les constructions par
ordinateur constitue un excellent exercice d'autoévaluation immédiate ; ainsi, la
possibilité pour les élèves de créer un voile d'injection de faible perméabilité
puis d'en simuler les conséquences hydrogéologiques, comme le ferait un
professionnel, gratifie leurs efforts ; c'est un moyen de progression rapide vers
une solution aux problèmes hydrogéologiques posés (fig. 16).
- le vocabulaire scientifique n'a pas dérouté les élèves de première B parce
que les concepts très spécialisés auxquels il fait appel (transmissivité, milieu
isotrope ou anisotrope, itération...) ont été préparés avec l'aide des professeurs
de sciences physiques et de mathématiques. Pour comprendre ce que représente
un barrage dans son environnement, le travail s'est poursuivi avec les
professeurs de sciences physiques, de géographie et d'économie.
En résumé, le logiciel H Y D R O S , éminemment scientifique au départ, a été
reçu comme un outil interdisciplinaire permettant à des élèves préoccupés
d'économie de s'investir, comme les professionnels, dans un travail très
complet faisant de l'ordinateur un outil de simulation prévisionnelle que la
visualisation graphique rend accessible en dépit de traitements mathématiques
puissants.
L'expérimentation s'achève par le besoin affirmé d'affiner le maillage du
modèle préalablement bridé, pour rejoindre une précision proche de celle du
logiciel professionnel originel.
B. Utilisation du logiciel ECO L'EAU pour comprendre
et représenter la dynamique temporelle d'une nappe d'eau
La mise en exploitation de la retenue d'eau du site d'Allevard a nécessité
l'emploi du modèle mathématique à l'origine d'ÉCO L'EAU pour prévoir le
comportement de la nappe alluviale. L'exploitation du logiciel au lycée s'étend
à d'autres projets la concernant, susceptibles d'être soumis au professionnel.
Confronté au problème de compréhension de la dynamique de la nappe, l'élève
doit juger de l'opportunité d'approvisionner en eau les aciéries dïAllevard,
d'irriguer des cultures de maïs dans la vallée, de poser des drains pour
optimiser en toute sécurité la capacité de la retenue du Flumet.
1. Activités des élèves
Prérequis : concepts de roche sédimentaire et de formation sédimentaire,
d'aquifère, de porosité et de perméabilité, lecture d'une carte topographique.
Matériels : photographies aériennes du site, photographies d'affleurements,
carte géologique
carte topographique à 1/25000 de la région AAllevard,
simplifiée à la même échelle.
Vocabulaire et mots-clés : bassin versant, ruissellement, infiltration,
précipitations immédiates et retardées, évapotranspiration, réserves facilement
utilisables, eau capillaire, niveau piézométrique.
a. Comprendre le fonctionnement d'une nappe d'eau : tester un modèle de
site.
La retenue artificielle du Flumet exploitée par E D F constitue un modèle
hydrogéologique. Le fond de la vallée est occupé par des formations
fluvioglaciaires constituées de roches meubles, poreuses et perméables dans
lesquelles l'eau circule.
Par le biais de cartes et de coupes schématiques du site, le logiciel sollicite le
réinvestissement des acquis : connaissances de terrain sur les propriétés des
roches et sur la mise en circulation de l'eau liée aux conditions géographiques
et géologiques du lieu, expériences de laboratoire sur le fonctionnement d'un
modèle hydraulique selon les caractéristiques hydrodynamiques, en particulier
la perméabilité de l'aquifère.
ECO L'EAU permet à l'élève de tester ses hypothèses sur les facteurs
susceptibles de faire varier le niveau supérieur d'une nappe. Pour cela :
- il consulte les éléments cartographiques qui précisent l'origine de l'eau de la
retenue : limites du bassin versant, sens de circulation de l'eau, propriétés des
roches qui constituent l'aquifère et le soubassement étanche de la nappe (fig.
19),
'
Ruissellement
Alluvions
<Aquifère)
Fig. 19.- Carte et coupe géologiques
Flumet.
Schistes
noirs
simplifiées
Schistes
cristallins
du site de la retenue
du
- il situe les piézomètres P l , P2, P3 et P4 par rapport à la retenue, fait des
mesures de niveau d'eau pour comprendre le fonctionnement d'un piézomètre
et constate le caractère cyclique, annuel des variations de niveau piézométrique
(fig. 20),
Fig. 20.- Niveaux piézométriques
relevés au piézomètre Pl (mesure
cours : le 7 janvier 1978). La poursuite des mesures ferait apparaître
caractère cyclique des variations du niveau supérieur de la nappe.
en
le
- il sélectionne une période -deux ans au moins- et un piézomètre pour
extraire de la banque de données climatiques et piézométriques les mesures de
précipitations, de températures et de niveaux piézométriques faites pendant
cette période en ce point,
- il fait afficher la courbe de variation du niveau piézométrique en fonction
du temps et il appelle, dans l'ordre qui lui convient, les courbes
correspondantes des précipitations et de la température pour les comparer et
les mettre en relation avec celle du niveau piézométrique ( fig. 21),
Une première observation s'impose à l'issue des thèmes abordée dans le bloc
A du logiciel, pratiquement indispensables à la poursuite des activités : les
précipitations ne montrent pas les variations annuelles observables pour le
niveau piézométrique ; l'hiver constitue la saison la plus efficace pour
alimenter la retenue ; la température influe considérablement sur l'efficacité
des précipitations.
Pour préciser la relation entre facteurs climatiques et niveau piézométrique,
l'élève peut compléter son analyse par les thèmes du bloc B :
- il repère, d'un trait, les maxima et minima des niveaux piézométriques et
des précipitations de la période considérée pour visualiser et pour déterminer
le retard de la montée du niveau d'eau, si elle a lieu (une semaine environ dans
les conditions topographiques et géologiques du Flumet : fig. 7),
Fig. 2 1 . - Variations du niveau piézométrique, des précipitations
et de la
température à Allevard, sur une durée choisie de 3 ans. Sous nos climats,
l'influence des précipitations est la plus faible en été.
- il détermine l'influence des précipitations suivant les saisons pour la période
considérée et il en déduit les précipitations efficaces (fig. 8),
- il consulte la courbe de variation du débit des source en fonction de la
hauteur d'eau : plus la différence d'altitude est grande entre le niveau supérieur
de la nappe et la source, plus le débit de celle-ci est élevé ; il peut aussi
déterminer les moments de la période choisie pendant lesquels l'aquifère se
vide comme un réservoir percé (fig. 12).
Suivant les thèmes du bloc B abordés, l'élève conclut sur les modalités de
remplissage et/ou de vidange du réservoir que constitue l'aquifère. La synthèse
explicative du raisonnement hydrogéologique complet relatif à l'influence des
précipitations sur les variations du niveau piézométrique précise les facteurs de
la dynamique temporelle de la nappe : la pente et la perméabilité de l'aquifère
interviennent par l'intermédiaire du ruissellement et de l'infiltration, la
température influe par l'évaporation et l'évapotranspiration sur les
précipitations efficaces qui alimentent effectivement la nappe.
b. Modéliser la dynamique d'une nappe : prévoir l'influence de chaque
facteur sur son comportement
Le modèle hydraulique complet fait intervenir cinq récipients entre lesquels
l'eau peut circuler :
- si l'élève choisit le modèle complet, tous les récipients sont mis en relation
fonctionnelle (fig. 26),
- s'il choisit le modèle à assembler, tous les récipients, sauf l'aquifère occupé
par la nappe, restent vides (fig. 22),
Précipitations ;
; Évapotranspiration
Réserves du sol
NAPPE
Sourœs
Fig. 22.- Les éléments
nappe.
du modèle à assembler pour faire fonctionner
la
Dans les deux cas, le logiciel récapitule l'état des composants du modèle avant
la validation du choix. Pour chaque facteur, l'élève a la possibilité de modifier
les options affichées : l'option 0 "pour savoir" donne des informations
graphiques qui visent à faciliter le choix entre les options 1 et 2, ; l'option 1
commande de ne pas prendre le facteur en compte, alors que l'option 2 donne
la directive contraire.
En appelant l'option 0, l'élève lance une animation qui, suivant le facteur
considéré, montre comment les précipitations efficaces et retardées se relaient,
permet de comprendre l'incidence de l'évapotranspiration suivant les
conditions climatiques et édaphiques (fig. 23), active la vidange d'un réservoir
percé.
1
2
3
4
Fig. 23.- Option "pour savoir" relative aux réserves facilement
Une à une, les animations s'enchaînent
climatiques au cours de Vannée.
comme
varient
utilisables.
les
conditions
Par temps froid et pluvieux, les précipitations
alimentent les réserves
facilement utilisables qui augmentent (1 et 2) et lorsque la saturation est atteinte
(3) alimentent la nappe. Puis la chaleur survient et les réserves diminuent par
évaporation (4). L'animation suivante, en période sèche, permettrait
d'assister
à leur épuisement.
Ayant choisi les composants de son modèle hydraulique, l'élève fait
fonctionner celui-ci jusqu'à ce que, par approximations successives, les
phénomènes s'enchaînent conformément à la réalité.
Il peut également jouer sur les précipitations et sur l'évapotranspiration pour
éprouver ses hypothèses concernant l'influence de ces facteurs sur les
variations du niveau piézométrique (fig. 9).
L'élève peut aussi appeler les courbes du modèle mathématique correspondant
au modèle hydraulique retenu (fig. 10).
Il peut en outre, au delà de la période prise en compte, interroger
l'ordinateur pour tester ses hypothèses sur l'incidence de pluies réalistes, voire
de pluies théoriques, jusqu'au cas limite d'un arrêt total des précipitations
accessible par l'indication "pas de pluie" (fig. 24 et 25).
Le retour au réel, avec par exemple en 1978 les perturbations dues aux
travaux EDF, confère sa validité au modèle informatique de fonctionnement de
la nappe.
c. Simuler la dynamique de la nappe en exploitation : apprécier la faisabilité
d'un projet et prévenir les risques.
Une bonne gestion des réservoirs naturels impose de maintenir le
renouvellement des réserves souterraines. La connaissance du devenir de la
nappe exploitée permet à l'élève de vérifier l'exactitude de ses prévisions
concernant l'impact d'un pompage sur les variations du niveau supérieur de la
nappe.
Un projet porte sur l'alimentation en eau d'aciéries dans la vallée du Flumet.
L'élève utilise les informations du modèle pour juger de l'opportunité d'un
pompage. Il s'informe sur les contraintes techniques : niveau piézométrique
minimal à respecter pour ne pas épuiser la nappe, débit minimal à maintenir au
Flumet, débit important et constant requis pour le pompage industriel, puis il
choisit le piézomètre près duquel serait réalisé le puits.
Pour tester la faisabilité du projet, il simule le pompage dans les conditions
climatiques de la période de mesures puis avec toutes les pluies possibles dans
la région. En considérant l'incidence du pompage sur le niveau piézométrique,
il explique l'impossibilité de pomper à certaines périodes. En argumentant à
partir de l'analyse des résultats confrontée à la demande, il montre pourquoi le
projet d'exploitation de la nappe n'est pas réalisable (fig. 24).
P r é c i p i t a t i o n s <m»)
Il il. . I ,. ,1 J. I. .Il I. .Il . .... Illl
!ll!!ffl]!!|fl![iriliIfll!l^îflJllll!flii!ITl
iL
E v a p o t r a n s p i r a t i o n p o t e n t i e l l e <m>
i
—
w
— avec pompage
1500
Dints^»eTrës"^ûp^s^â7Têurê)"'
1976
1975
F I - Que f a i r e ?
F2 -
Commentaires
— sans pompage
t Pompage
1977
1978
Pas de p l u i e
ri - Menu g é n é r a l (et f i n d'ECO L'EftU)
Fig. 24.- Simulation graphique de l'étude de faisabilité d'un pompage destiné
à alimenter une industrie : elle permet de prévoir un abaissement
considérable
du niveau piézométrique à la suite du pompage dont le débit ne pourrait être
maintenu.
Un autre projet concerne l'alimentation en eau d'un champ de maïs dans la
vallée. L'arrosage prévu de mai à octobre par prélèvement dans la nappe doit
garantir la survie des plantes par un taux de saturation minimal des réserves
utiles du sol. Pour savoir si la culture du maïs est possible :
- l'élève s'informe sur les contraintes techniques du projet : niveau
piézométrique minimal à respecter, débit requis pour le pompage exploité
chaque année pendant la durée du cycle de vie des plantes dès que le taux de
saturation des réserves utiles descend à 80%, maintien de ce débit jusqu'à ce
que les réserves soient saturées,
- il interroge l'ordinateur afin d'envisager l'incidence de toutes les
distributions annuelles possibles de pluies réalistes sur la région d'Allevard,
- en s'appuyant sur les résultats, il indique si le projet d'irrigation lui paraît
réalisable (fig. 25),
60
40
Il
20
.1 .
Il
ïkhW
iul
0
1 Ji inll h J
i.iii,
IiLiU'I
Evapotranspiration p o t e n t i e l l e ( — )
1, 0T
0
a u x
1
de s a t u r a t i o n des r e s e r v e s
'V IWU
80
60
40
20
0
Niveaux D i é z o » * t r i o u e s <»>
utiles
1
W
• courbe i n f . = avec pompage,
courbe sup. = sans poapaqe
I — Faites votre nappe — |
Pluies réalistes
•
Pluies théoriques
Débits (mètres cubes / h e u r e )
—» Sources
1976
I
'—• Pompage
1377
Fig. 25.-Simulation graphique d'une étude de faisabilité d'un pompage
irrigation : l'impact du pompage sur le niveau piézométrique est faible.
I
pour
Une conclusion s'impose : l'exploitation du gisement d'eau ne remet pas en
cause l'état d'équilibre entre les apports et les pertes de la nappe.
Sachant qu'une grande part de l'eau d'arrosage retourne à la nappe, le modèle
modifié pour représenter la perturbation réintroduit l'eau pompée dans le
réservoir des précipitations (fig. 26).
^
-
irrigation )—
précipitations évapotranspiration
pompage
Fig. 26.-Schéma fonctionnel du modèle hydraulique adapté à une irrigation :
l'eau pompée dans la nappe alimente le réservoir des précipitations
qui
alimente lui-même les réserves du sol et l'évapotranspiration.
Pour accroître la capacité de la retenue, EDF a creusé le marais du Flumet en
créant un talus de 12 m de hauteur. L'eau de la nappe montait dans le talus en
menaçant sa stabilité. Afin de prévenir les risques, EDF met en place des drains
(fig. 27).
Fig. 27.- Mise en place de drains visant un rabattement optimal d'une nappe
pour prévenir localement un glissement de versant.
Pour contrôler l'efficacité propre des drains à faire baisser la nappe :
- l'élève cherche à quel (s) moment (s) le niveau enregistré par le piézomètre
P4 était plus élevé que le niveau calculé (fig. 11 : période de contrôle du
modèle),
- il détermine l'influence des sources et celle des drains qui se comportent
comme une source supplémentaire dont le débit dépend de la hauteur d'eau au
dessus des drains.
Il conclut en expliquant l'efficacité des drains, supérieure à celle des sources.
2. Évaluation des résultats de l'expérimentation d'ÉCO
L'EAU
en classe
L'expérimentation a eu lieu dans trois classes de seconde et s'est déroulée en
trois phases : une en 1990-1991 et deux en 1991-1992. L'utilisation du logiciel
en mai 1992 par une classe abordant tardivement la partie de programme
correspondante a permis de tester la dernière version du produit.
a. La première phase devait permettre de juger des possibilités du produit en
cours d'élaboration. Pour cela, les élèves répondaient, grâce à l'ordinateur, au
problème posé par une étude pratique antérieure sur matériel traditionnel :
quels facteurs conditionnent l'alimentation d'une nappe.
Les élèves disposaient alors d'un ordinateur pour cinq. Après une séance de
travaux pratiques de deux heures, l'évaluation de leurs réactions aux premiers
modules d'ÉCO L'EAU a eu lieu.
En dépit de problèmes de lecture dus au nombre d'élèves par poste et liés aux
petites dimension des caractères affichés à l'écran, le logiciel a été bien reçu.
Au delà du prérequis fourni par les travaux pratiques précédents, cette séance
témoigne du fait que tous les élèves ont saisi l'importance de la température
dans l'alimentation d'une nappe. Leurs conclusions attestent qu'ils ont modifié
leur modèle mental de fonctionnement des nappes.
Cette première étape de l'expérimentation a révélé l'importante dynamique
induite au sein des groupes par l'utilisation du logiciel. Le recours aux
argumentations pour convaincre les camarades de classe a constitué un point
fort, accru par la possibilité de vérifier ou de contredire, par simulation à
l'ordinateur, les affirmations de chacun.
a. La deuxième phase, en 1991-1992, avait au départ un objectif peu différent
de la précédente : comprendre la dynamique d'une nappe d'eau souterraine.
Les thèmes de l'analyse (blocs A et B du logiciel) ont cet objectif premier.
Comme pour H Y D R O S , le modèle numérique suppose l'utilisation préalable
des outils traditionnels pour accéder aux faits et pour préparer sa validation.
Après un travail sur cartes, aidé du logiciel, le site hydrogéologique dtAllevard
est repéré, de même que l'emplacement des piézomètres.
Dans la recherche des facteurs de variation du niveau supérieur de la nappe,
l'ordre dans lequel les élèves appellent les courbes significatives du climat
exprime leur croyance quasi unanime en l'action quasi exclusive de la pluie (fig
21).
En dépit des croyances, l'analyse graphique induit l'hypothèse de l'incidence
de la température sur l'évapotranspiration et sur les variations du niveau
supérieur de la nappe d'eau. La démonstration lève un obstacle de poids chez
les élèves convaincus de l'intervention des seules précipitations.
La recherche de l'influence des saisons, autrement dit la généralisation de la
notion de précipitations efficaces laisse aux élèves le soin de déterminer la
pente des courbes : ce choix provoque des dialogues montrant, en particulier,
les avis partagés sur l'opportunité de faire passer ces courbes par l'origine (fig.
8). Les modalités de vidange d'un aquifère révèlent la difficulté des élèves pour
distinguer la vidange réelle de la vidange théorique en l'absence de
précipitations efficaces. Les courbes étant jugées trop complexes par les élèves,
cette partie a dû être repensée.
L'étude montre la nécessité pédagogique de délimiter nettement les thèmes
pour isoler les facteurs. Très ciblé, le travail d'analyse constitue un premier
niveau de formulation du concept de facteur, trop prématuré pour entraîner
une formulation généralisante.
Les thèmes consacrés à la modélisation de la dynamique d'une nappe offrent
le retour à l'interdépendance des facteurs mais une interdépendance
schématique, simplifiée et clarifiée. La comparaison du modèle théorique de
transit de l'eau dans l'aquifère avec les résultats réels le font considérer comme
insuffisant, ce qui fait rebondir le problème. L'approche dynamique facilite
l'acquisition de la difficile notion de réserves facilement utilisables.
Intéressés par la modélisation et surtout par les simulations, les élèves
regrettent que la durée de l'analyse ait raccourci d'autant le temps qu'ils
peuvent y consacrer. Il n'est pas nécessaire de parcourir toutes les étapes de
l'analyse avant de s'intéresser aux modèles.
L'expérimentation montre que la seule modélisation, voire la seule
simulation, permettent d'abstraire rapidement les facteurs du fonctionnement
des nappes d'eau, accessibles par ailleurs plus progressivement donc plus
aisément par l'analyse. La modélisation exprime un souci plus grand de
généralisation. Il n'est d'ailleurs pas impossible d'aborder directement la phase
de simulation sur ordinateur si la modélisation a été envisagée autrement, à
l'aide d'un modèle physique traditionnel, hydraulique par exemple.
La validation du modèle par le réel a convaincu les élèves. Le choix de
l'année 1976, pour comparer les résultats du modèle théorique aux mesures
réelles leur permet de nuancer les conclusions. Mais, arrivés à ce stade,
certains ne comprennent plus et se contentent de reprendre les conclusions du
logiciel sans en rechercher la signification. Au moment d'utiliser le modèle
complet proposé, les élèves étaient interrogés sur sa conformité au réel et sur
l'opportunité de son choix. Leurs réponses montrent qu'une construction par
étapes n'aurait pas été inutile. Avant la phase suivante de l'expérimentation, une
nouvelle adaptation du logiciel prévoit de les faire participer à l'organisation et
à l'amélioration progressive du modèle.
La suite de l'emploi du logiciel en classe s'organise autour d'études
prévisionnelles liées à l'exploitation de la nappe. Leur abord est permis par les
simulations.
Avant d'aborder un problème de gestion de la nappe, un exercice intégré vise
à faire le point des acquis de la modélisation (fig. 24).
"Prévoir, par une hypothèse graphique, l'influence d'un arrêt total des
précipitations en prolongeant le tracé de toutes les courbes pour la période
correspondant à l'indication pas de pluie. "
L'évaluation montre à quel point le modèle sert d'appui aux élèves : hormis
les hésitations pour exprimer graphiquement une hypothèse sur l'évolution des
réserves facilement utilisables (R.F.U.) en l'absence de pluie, évolution difficile
à prévoir sans ordinateur, les élèves ayant compris l'énoncé donnent une
réponse graphique globalement cohérente.
Lorsque des problèmes majeurs existent, ils naissent de la lecture du texte et
de sa traduction sous forme graphique : six élèves sur seize n'ont pas compris
ce que signifie graphiquement «arrêt total des précipitations». A l'opposé, ceux
qui ont su poser le problème graphiquement révèlent, par leur représentation
qu'ils ont tous anticipé les faits par une simulation cohérente sinon exacte en
l'absence de données numériques (fig. 28).
EXPLOITATION D'UN MODÈLE
POUR SIMULER L'INFLUENCE
DE DIFFÉRENTS FACTEURS
SUR UN NIVEAU PIÉZOMÉTRIQUEI
FORMULATION
DUNE HYPOTHÈSE|
GRAPHIQUE
PRÉCIPITATIONS
EVAPOTRANSP.
RÉSERVES F. U.
NAPPE SANS P.
NAPPE AVEC P.
SOURCES
POMPAGE (P.)
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
EN GRISÉ : RÉPONSES CORRECTES D'UN GROUPE DE TRAVAUX PRATIQUES (16 ÉLEVÉS).
Fig. 28.- Évaluation des résultats d'un groupe d'élèves de seconde à un
exercice de simulation graphique sur papier mettant en œuvre une démarche
déductive.
Destinée à vérifier la maîtrise du modèle informatique pour motiver son
emploi dans une recherche quantitative précise, elle montre la nécessité, avant
d'utiliser un modèle, sur papier ou sur ordinateur, de bien contrôler que
l'élève s'est véritablement approprié le problème.
Sur leur graphique, la plupart des élèves font descendre le niveau
piézométrique plus bas que la base de l'aquifère. Ceci fait apparaître la
nécessité de bien insister sur les caractéristiques de l'aquifère de la nappe
étudiée par un retour à la corrélation du modèle au réel. Ceci encourage les
professeurs à bien définir les contraintes en cas d'exploitation de la nappe.
Les élèves ayant bien compris le fonctionnement du modèle ont réussi à
s'approprier efficacement et à simuler les réponses au problème d'alimentation
en eau des aciéries, au projet d'irrigation et même de mise en service des
drains devant la menace de déstabilisation du talus. Mais, plus le temps passe,
plus l'écart se creuse entre ceux qui adhèrent à la démarche et ceux qui,
manifestement, ne font pas l'aller et retour mental nécessaire entre modèle et
réel. Il faut adapter le pas au cheminement des élèves qui n'ont pas suivi la
démarche déductive et n'ont pas compris la simulation.
Une évaluation sommative aide à préciser les apprentissages : la même
interrogation, de même durée -quinze minutes au maximum- sur les facteurs de
variation d'une nappe alluviale, est conduite au début et à la fin de l'étude des
nappes d'eau employant le logiciel ECO L'EAU.
Les données de terrains, de laboratoire et les modèles étudiés permettent aux
élèves d'améliorer le schéma fonctionnel de nappe déjà demandé au stade des
prérequis :
"- construire un schéma de nappe souterraine,
- indiquer sur le schéma comment se font les entrées et les sorties d'eau,
- conclure en précisant les causes de variation du niveau supérieur de la
nappe."
L'exercice appelle des réponses sous forme à la fois textuelle et graphique :
une redondance en apparence seulement quand on sait que les élèves maîtrisent
plus ou moins les deux modes de communication. Toutes les réponses correctes
sont prises en compte et distinguées suivant qu'elles sont exprimées par le texte
ou par le graphisme. Dans ce dernier cas, une orientation exprimée, par des
flèches, des entrées et sorties vient accroître les performances (fig. 29).
La comparaison des réponses exprimées au stade des conceptions préalables
et en fin d'expérimentation confirme le rôle essentiel du logiciel dans la mise
en évidence du rôle de l'évapotranspiration. Elle fait apparaître une prise de
conscience de la place des réserves facilement utilisables. Mais les progrès
concernant le fonctionnement de l'aquifère sont mineurs et les élèves ont du
mal à replacer en vraie grandeur les facteurs du modèle maîtrisé : l'évaluation
montre la difficulté à s'approprier un modèle dans le contexte du réel sans
substituer le modèle au réel.
Cette évaluation sommative portant sur toute l'étude des nappes d'eau fait
apparaître des progrès globaux de la classe au niveau graphique et textuel,
somme de progrès individuels, graphiques ou textuels, rarement les deux. Le
fait qu'ils ne concernent pratiquement pas l'aquifère montre l'intérêt de
recadrer à chaque instant le nouveau modèle au regard du réel. Ainsi se
confirme la nécessité d'un double entraînement des élèves à la lecture et à
l'écriture, textuelles et graphiques. Ainsi se confirme la nécessité de bien
définir le champ de validité, autrement dit le cadre de référence des
démonstrations et des lois au fur et à mesure qu'avec les nouveaux
apprentissages les acquis, donc le cadre de lecture des élèves, grandissent. Pour
une appropriation véritable des concepts, les changements successifs de cadre
de référence doivent être clairement précisés. C'est particulièrement vrai dans
une approche pédagogique exploitant l'ordinateur pour modéliser des
phénomènes sur lesquels on expérimente difficilement en vraie grandeur [C.
Haguenauer, 1991]. Dans leur grande majorité, les élèves voient dans la nappe
le produit d'une accumulation progressive d'eau qui ne dépend que de la
quantité de pluie tombée, infiltrée puis emprisonnée dans des cavités, des
rivières souterraines ou des sortes de réservoirs naturels, lacs souterrains,
«grosses bulles» qu'avec le temps des fissures vidangent.
La nécessaire saturation de la zone des réserves utiles, bien comprise de tous
en fin d'étude, rompt avec cette croyance. Cet obstacle levé, les élèves
relativisent l'incidence d'un pompage, suivant qu'il a lieu en été ou en hiver.
FACTEURS DE VARIATION DE LA QUANTITÉ D'EAU D'UNE NAPPEI
nombre
d'élèves
: 26
CONCEPTIONS PRÉALABLES!
20
Réponses
correctes
relatives
aux 1 0
différents
facteurs
Précipitations Évaporation
FACTEURS
nombre
NOMMÉS
d'élèves
Réserves du
sol
Sources
REPRÉSENTÉS
: 26
Prélèvements
Aquifère
ORIENTÉS
CONCEPTIONS A LA FIN DU CHAPITRE|
INCLUANT LES TRAVAUX PRATIQUES
SUR ECO L'EAU
20
Réponses
correctes
relatives
aux 1 0
différents
facteurs
Précipitations Évaporation
FACTEURS
NOMMÉS
Réserves du
sol
Sources
REPRÉSENTÉS
Prélèvements
Aquifère
ORIENTÉS
Fig. 29.- Analyse comparée des résultats d'une classe de seconde à un exercice
de contrôle de l'acquis énoncé de façon identique en début et en fin de chapitre,
en utilisant un vocabulaire volontairement général ne faisant pas référence au
logiciel
En démontant l'idée simpliste que les pluies alimentent directement les
nappes, l'utilisation du logiciel entraîne un remaniement complet des
conceptions sur le rôle des précipitations dans le fonctionnement d'une nappe et
elle ancre dans le réel le concept de précipitations efficaces. En revanche, le
concept de transmissivité qu'elle exploite ne s'étend pas à l'ensemble aquifère et
nappe dont les éléments restent séparés dans l'esprit des élèves occupé par leur
modèle personnel.
3. La troisième phase du protocole succède à cette expérimentation très
complète qui visait à tester largement le logiciel et les capacités des élèves.
Cette nouvelle expérience offre aux élèves d'autres classes un temps plus court
sur ordinateur pour répondre à des problèmes moins nombreux, choisis par le
professeur.
Une première évaluation a porté sur la réponse des élèves à la question
suivante :
"Quel(s) facteur(s) climatique(s) détermine(nt) le niveau de remplissage des
nappes d'eau ?"
Les résultats d'une classe, obtenus avant les travaux pratiques sur ordinateur,
renseignent sur les préacquis : un élève en moyenne sur neuf répond
correctement en mentionnant à la fois la pluie et la température ignorée des
autres élèves.
Quelle que soit la partie du logiciel exploitée par les élèves -analyse ou
modélisation- pendant la séance sur ordinateur, la quasi totalité de la classe
donne une réponse bonifiée à l'issue d'une séquence d'une heure trente utilisant
le logiciel ECO L'EAU.
Une évaluation plus fine porte sur la partie du logiciel consacrée à l'analyse
pour un groupe de 17 élèves d'une autre classe. Pour évaluer ce que
ECO L'EAU leur apprend, ils doivent répondre d'abord aux questions suivantes
et, deux heures plus tard, modifier ou compléter, si besoin, leurs réponses :
"Qu'est-ce qu'un aquifère ?
Qu'est-ce que le niveau piézométrique d'une nappe d'eau ?
Qu'est-ce que le rabattement d'une nappe ?
Qu'est-ce qui fait varier le niveau supérieur d'une nappe ?"
L'évaluation confirme les erreurs des élèves relatives au concept d'aquifère,
erreurs nées de conceptions initiales que le logiciel ne déstabilise pas. Le
concept de perméabilité d'une roche, bien perçu à l'échelle de l'échantillon,
n'est pas maîtrisé dans le cadre de référence du terrain, à fortiori dans celui du
modèle.
Des concepts apparemment plus nouveaux tels que celui de niveau
piézométrique ne souffrent pas de ce changement de cadre.La définition de la
notion de battement d'une nappe s'enrichit d'une référence au temps
climatique. Les progrès les plus spectaculaires concernent les facteurs
climatiques de variation du niveau supérieur de la nappe (fig. 30).
Fig. 30.- Analyse comparée des résultats d'une classe de seconde à un test en
deux temps faisant évaluer par les élèves eux-mêmes l'acquis sur les causes de
variation du niveau supérieur d'une nappe alluviale après une séquence d'une
heure et demie de travaux pratiques sur ordinateur.
L'évaluation montre une nette amélioration dans la rigueur du vocabulaire,
sauf en ce qui concerne l'aquifère. Les difficultés rencontrées par les élèves
pour entrer dans les problèmes s'amenuisent quand a lieu un accompagnement
scientifique du logiciel visant à mieux maîtriser la notion d'aquifère par un
retour permanent aux conditions du réel (fig. 15).
En résumé, ECO L'EAU aide à bien comprendre les méthodes, à connaître les
instruments et les unités de mesures. Il précise les conditions de remplissage et
de vidange des aquifères et permet de comprendre le sens de circulation de
l'eau. En relativisant le rôle des différents facteurs, il offre l'ancrage
scientifique indispensable au concept de gestion des ressources. ECO L'EAU et
H Y D R O S résolvent des problèmes de nappes ancrés dans les préoccupations
actuelles face à l'évolution de notre environnement. L'objectif était de donner
aux élèves une attitude scientifique, leur critique des médias misant sur les
pluies estivales pour alimenter les nappes s'avère encourageante.
C. Perspectives offertes par les logiciels ECO
L'EAU
et
HYDROS
- Les acquis du collège déterminent les prérequis du lycée. L'exploitation des
logiciels au collège de DIEULOUARD, avec des élèves de classe de quatrième, a
permis de cerner les capacités qu'il est possible de mettre en œuvre par une
éventuelle extension de l'emploi d'ÉCO L'EAU et d'HYDROS au collège.
A l'issue du collège, un élève doit pouvoir caractériser les relations entre la
roche et l'eau et avoir conscience de la dynamique des nappes dans leur
aquifère. L'entraînement répété sur ordinateur à la construction individuelle
des lignes de courant et l'obtention des courbes de variations dans le temps du
niveau piézométrique facilitent cette approche à condition que la prise de
conscience de l'existence d'une nappe ait lieu dans le contexte du réel.
L'évaluation va se poursuivre par l'intermédiaire de professeurs de collèges
et de lycées qui utilisent les logiciels en formation continue et dont les
établissements ou les laboratoires sont dotés d'ordinateurs. Comme pour le
groupe de recherche, le type d'exploitation évoluera avec leur niveau
d'équipement.
- Des journées ont été consacrées à cette formation en 1990-1991 et en 1991 1992, à l'occasion de stages de géologie organisés dans le cadre de la
M . A . F . P . E . N . de N A N C Y , conjointement avec l'Université de N A N C Y I. Un
nouveau stage aura lieu en 1992-1993. L'augmentation du nombre de salles de
travaux pratiques équipées d'ordinateurs et la publication par le C.R.D.P. de
NANCY-METZ de 17 fiches descriptives de logiciels de biologie-géologie parmi
lesquelles figurent H Y D R O S et ECO L'EAU devraient étendre leur emploi. Une
convention entre E.D.F. et l'i.N.R.P. visant la diffusion de ces deux logiciels est
à l'étude..
- L'utilisation des logiciels par le personnel d'E.D.F. est prévue : une première
présentation est programmée pour la fin de l'année 1992 à la demande des
services de la Direction Régionale des Côtes du Nord.
Une synthèse permet de faire le point sur le renouvellement qu'apportent
et H Y D R O S à l'étude de la dynamique des nappes d'eau. Leur
emploi complémentaire intervient dans une problématique, déjà bien installée
par les médias, des caractéristiques qualitatives et quantitatives de l'eau des
nappes. Un avantage majeur réside dans leur lisibilité à plusieurs niveaux :
collège, lycée, classes préparatoires aux grandes écoles et formation
professionnelle. L'objectif commun consiste à représenter la nappe en
circulation dans l'aquifère, la problématique commune à déterminer de façon
quantitative l'incidence des facteurs de variation de ces nappes.
E C O L'EAU
réel au modèle pour revenir du modèle à une situation réelle. Cette
confrontation de la théorie et des faits est commune au praticien chercheur et à
l'élève en cours d'apprentissage. Héritiers des logiciels professionnels, HYDROS
et ECO L'EAU se pratiquent en trois étapes successives : analyse, modélisation,
simulation.
En résumé, nous avons retenu le caractère modélisant des logiciels conçus par
les hydrogéologues professionnels. L'approche systémique des facteurs de la
dynamique des nappes d'eau favorise l'emploi d'une démarche déductive. Outil
de stockage de données, de traitement mathématique et graphique et de
modélisation, l'ordinateur améliore grandement l'évaluation quantifiée et
visualisée de l'action de l'Homme sur son environnement. Pour cette raison, il
facilite l'acquisition des concepts scientifiques dynamiques de l'hydrogéologie
par les élèves mis en situation de simuler le comportement d'une nappe d'eau.
HYDROS et ECO L'EAU font du modèle un outil sans jamais le substituer
durablement au réel (fig. 31).
Fig. 31.- Le MODÈLE représente-t-il bien la réalité ? C'est la question que
posent
les logiciels. C'est aussi celle du professionnel
et du pédagogue
responsable des apprentissages. Le volume occupé par l'eau de la nappe (à
gauche) doit sans cesse être ramené au volume de l'aquifère qui la contient (à
droite).
PUBLICATIONS
- FISCHER J.-P. et HAGUENAUER C , 1985. - Informatique appliquée au Génie civil :
détermination des potentiels hydrauliques et du débit de fuite sous barrage, rabattement d'une
nappe autour d'un puits. - Rapport C.F.I.A.P. NANCY.
- HAGUENAUER C , 1991. - Comprendre par les cycles et les cycles pour apprendre. Thèse
de l'Université de N A N C Y I.
- C.R.I. de Nancy-Metz : ROYNETTE C , B A L Y J.., BERCHE P., BOULANGER J.-Y.,
FAURE P., GÉRARDIN B., HAGUENAUER C , KLEIN S., LÉGER B., LESTAN S.,
SCHMIT J.-F., 1992. - Biologie-Géologie. Fiches-logiciels 3, C.R.D.P. de N A N C Y , Fenêtre
active, Informatique pédagogique.
- B A LY J., BERCHE P., BOULANGER J.-Y., DEMASSIEUX L., H A G U E N A U E R B.,
H A G U E N A U E R C. JANIN Bl., KLEIN S., MAZENOT P., 1991. - Les nappes d'eau :
analyse d'exemples réels, modélisation et simulation de leur fonctionnement. L'informatique
scientifique dans l'enseignement de la biologie et de la géologie au lycée. J.-C. D U V A L et N.
SALAME (eds), Paris, INRP, 1991.
BIBLIOGRAPHIE GÉNÉRALE
- ANTOINE P. et FABRE D., 1980. - Géologie appliquée au génie civil. - Paris : Masson.
- BODELLE J. et MARGAT J., 1980. - L'eau souterraine en France. - Paris : Masson.
- CASTANY G. et BLAVOUX B., 1984. - Hydrogéologie. - Encyclopaedia Universalis, t. 8.
- CASTANY G., 1982. - Principes et méthodes de l'hydrogéologie. - Paris : Dunod.
- CHAUVE P., 1992. - Ressources en eau. - in Enseigner la géologie au collège et au lycée. Collection pratiques pédagogiques.- Paris : Nathan.
- ERHARD-CASSEGRAIN A. et MARGAT J., 1983. - Introduction à l'économie générale de
l'eau. - Paris : Masson.
- GOGUEL J., 1967. - Application de la géologie aux travaux de l'ingénieur. - Paris : Masson.
- LABESSE B., 1985. - La géologie au service des Hommes. - Société géologique de France.
Entretiens de Saint-Cloud.
-LETOURNEUR J. et MICHEL R., 1971. - Géologie du génie civil. - Paris : Colin.
- MARSILY G. de, 1981. - Hydrogéologie quantitative. - Paris : Masson.
- MARTY M., 1984. - Barrages. - Encyclopaedia Universalis, t. 3.
- SOCIÉTÉ GÉOLOGIQUE DE FRANCE, 1990. - Les fondations des grands ouvrages,
mémoire n° 157.
- TARDY (Y.), 1987. - Le cycle de l'eau. - Paris : Masson.
BIBLIOGRAPHIE SPÉCIALISÉE
- BOULY S. et DEMASSIEUX L., 1981. - Pollution de la nappe alluviale de la Moselle à Loisy
(54).
- BOURGIN A., 1955. - Cours de calcul de barrages. - Paris : Eyrolles.
- Laboratoire Central des Ponts et Chaussées, 1982. - Reconnaissance géologique et
géotechnique des tracés de routes et d'autoroutes. Note d'information technique. - Ministère de
l'urbanisme et du logement - Ministère des transports.
- GISCLARD G. - De quelques modèles analogiques à des mesures d'hydrogéologie sur le
terrain. - Thionville : à paraître.
- RAMON S. et PETITJEAN E., 1984. - Hydrocarbures et eaux souterraines, la lutte contre les
pollutions accidentelles. - Agence de Bassin Rhin-Meuse.
- THONON P., 1992. - Géologie et grands travaux. - dans Enseigner la géologie au collège et
au lycée. - Collection pratiques pédagogiques. - Paris : Nathan.
- VARLET H., 1966. - Barrages-réservoirs. - Paris : Eyrolles.
LA GESTION DES RESSOURCES EN EAU
Approche à partir des données
et des logiciels généraux
J.M. Coulais, J. Coutable, P. Giraudeau, J J . Bernard
L'équipe est redevable pour leur concours aux organismes suivants :
- Agence de Bassin Loire-Bretagne, Orléans
- Bureau de Recherche Géologiques et Minière, Poitiers
- Service Régional d'Aménagement des Eaux des Deux-Sèvres, Poitiers
- Direction Départementale de l'Agriculture des Deux-Sèvres, Niort
- Direction Départementale de l'Action Sanitaire et Sociale des Deux-Sèvres, Poitiers,
- Stations de la Météorologie Nationale de Poitiers-Biart et Niort
a
142
Pê
e
L A G E S T I O N D E S R E S S O U R C E S EN E A U
A p p r o c h e à p a r t i r des d o n n é e s et des logiciels g é n é r a u x
143
J J. Bernard, J . M . Coulais, J. Coutable, P. Giraudeau
I. L'APPROCHE D U PROBLEME
143
A. Les types de logiciels disponibles
B. Les données à recueillir
C. Les documents d'appuis
D. Les orientations de travail
II. LES BESOINS ET USAGES DE L'EAU
144
145
146
146
148
A. Thème d'étude : alimentation en eau potable,
organisation des unités de distribution.
1. Objectifs pédagogiques
2. Collecte et saisie des informations
3. Traitement de l'information
III. LES FLUX D'EAU ET LEUR GESTION
A. Objectifs pédagogiques communs aux différents thèmes d'étude
1. Problèmes à étudier
2. Savoirs
3. Savoir-faire
B. Collecte et saisie des informations
1. Organismes compétents
C. Les Thèmes d'étude
1. Thème : mise en évidence d'un flux et de ses variations
a. Exemple d'acquisition et d'utilisation de données expérimentales
b. Travail à partir de fichiers de données professionnelles
2. Thème : la gestion des flux d'eau
IV. L'EAU ET LES FLUX DE MATIERE
A. Objectifs pédagogiques communs, aux différents thèmes d'étude
1. Problèmes à étudier
2. Savoirs
B. La collecte des informations
1. Les paramètres de qualité
2. Organismes compétents
C. Le traitement des informations
1. Les données
2. Les logiciels
D. Les thèmes d'étude
1. Thème : étude des normes de potabilité à partir des fichiers de qualité
2. Thème : Qualité d'une eau et répartition géographique : la cartographie
3. Thème : Qualité et potabilité d'une eau
4. Thème : Corrélations entre paramètres de qualité des eaux
148
148
148
150
154
154
154
154
154
155
155
155
157
157
159
162
164
164
164
164
164
164
165
166
166
167
167
167
169
176
178
IV - CONCLUSIONS
180
ANNEXES
183
LA GESTION DES RESSOURCES EN EAU
Approche à partir des données
et des logiciels généraux
I. L ' A P P R O C H E D U P R O B L E M E
La gestion des ressources en eau par l'homme, dont le but principal est
d'augmenter la production de biomasse, est une question en pleine évolution.
L'approche de cette gestion à partir de données peut s'appuyer sur diverses
informations descriptives concernant la qualité et la quantité ; elle peut
également concerner les aspects dynamiques : existence d'un flux d'eau de
matières transportées.
L'étude qualitative concerne les phénomènes physico-chimiques, biologiques,
microbiologiques et biochimiques : la composition en substances minérales
dissoutes, la teneur en gaz dissous (O2 et C 0 surtout), les indices biotiques, les
phénomènes de pollution et leurs conséquences sur la production et la potabilité
des eaux, la production primaire et la vie animale.
2
L'étude quantitative repose sur la mesure des quantités d'eau stockée dans les
différents compartiments et sur l'évaluation des flux d'eau au niveau du bassin
versant : les entrées (pluviométrie), le stockage (piézomètrie), les sorties
(débits, ETP).
Le thème de l'eau n'étant abordé que depuis peu dans les lycées et les
collèges, le passé expérimental n'existe pas. Le renouvellement des activités
expérimentales dans ce domaine sera plutôt une création. La contribution de
l'informatique à ce renouvellement est évidente dans la gestion quantitative :
elle rend possible le traitement des très nombreuses données disponibles, de
plus en plus fournies par des stations automatiques de mesure. Son emploi est
moins net dans l'étude du problème de la qualité où elle permet néanmoins de
traiter des informations obtenues par des pratiques conventionnelles : analyses
chimiques, microbiologiques, examen de cartes. L'emploi de sondes permet la
mesure en continu de plusieurs paramètres : température, pH, conductimétrie,
teneur en dioxygène ; mais le dosage du CO2, reste problématique en l'absence
de sondes adaptées.
Quand on approche les milieux professionnels compétents dans le domaine
de la gestion de l'eau, on s'aperçoit que ce sujet n'est pas abordé de la même
manière par tous ceux qui y travaillent : la gestion quantitative de l'eau en est à
ses débuts, les approximations sont encore énormes.
La gestion quantitative des ressources ne s'est pas encore posée partout de
manière cruciale. En Poitou-Charentes, par exemple, le problème lié aux
prélèvements en eau pour l'irrigation des cultures de maïs grain et de tournesol
pendant la période d'étiage a créé la nécessité de mieux maîtriser les données
quantitatives. Cependant, la recherche de ces informations montre que :
- des lacunes importantes existent dans les relevés des données pour certains
bassins ; la pose de piézomètres permettant des relevés automatiques de
données y est récente,
- les bilans établis utilisent des valeurs décadaires, voire mensuelles pour
certaines données (météo), et des valeurs journalières pour d'autres (débits).
Certains paramètres ne sont pas bien connus, et fixés par convention (le
ruissellement à 50%, par exemple),
- les données sont souvent traitées manuellement ; l'emploi de l'outil
informatique étant en cours de développement, son apport pour la gestion des
ressources en eau n'est donc pas encore bien connu,
- les bilans effectués varient selon les organismes et les bassins. Ils étaient
limités les années précédentes à une évaluation des entrées et des sorties du
système, sans véritable calcul du stockage, car les paramètres ne sont pas
entièrement maîtrisés (en particulier la transmissivité dans les systèmes
aquifères).
En fait, la gestion des ressources en eau d'un bassin repose sur la
connaissance empirique du terrain par les hydrogéologues qui sont capables
d'évaluer les conséquences d'un prélèvement sur le stockage pour les terrains
qu'ils connaissent. Cela amène à conclure que aucune méthode reposant sur une
maîtrise des paramètres n'a de valeur universelle, ce qui rend difficile une
comparaison entre différents systèmes. Pour les professionnels en PoitouCharentes, gérer une nappe, c'est la gérer en Juillet et Août. L'eau pompée
pour l'irrigation sort du système, alors que l'eau pompée pour l'alimentation
en eau potable y retourne aux 3/4. La gestion de l'eau revient donc à gérer
l'eau pour l'agriculture.
A. Les types de logiciels disponibles
Quand on s'intéresse aux logiciels utilisés dans les milieux professionnels, on
constate l'existence de ressources non négligeables que l'on peut répartir en
trois catégories.
- La première est constituée par les logiciels très spécialisés, répondant à des
objectifs techniques propres à chaque organisme.
D'une convivialité inégale, ils s'adressent à des spécialistes connaissant bien
l'outil, et désireux d'obtenir une production bien ciblée. Le Bureau de
Recherches Géologiques et Minières ( B R G M ) , par exemple, possède un
"Département Eau" qui a développé plusieurs logiciels de ce type (cf. annexe
1). Il s'agit généralement de logiciels assez complets et lourds ; certains
seraient utilisables dans l'enseignement moyennant un transfert ardu.
-La deuxième catégorie comprend les logiciels offrant des fonctionnalités
nouvelles, comme la création de courbes d'isovaleur et leur représentation en
2D et 3D (Descartes Modélisation, Surfer, Excel), et la représentation
cartographique (Cartes et Bases sur PC, Carto 2D sur Mac).
- La troisième correspond aux applications présentant des fonctionnalités
équivalentes à celles des logiciels disponibles pour micro ordinateurs : les
gestionnaires de fichiers (Dbase, File Maker Pro, etc.), et les tableursgrapheurs (Excel, en particulier).
Ces logiciels généraux sont maintenant disponibles en grand nombre pour les
établissement scolaires (cf. annexe 1).
B. Les données à recueillir
Dans certains cas, les données hydrogéologiques peuvent être recueillies
localement par les élèves : les données météorologiques peuvent être acquises
avec une station météo portable installée à proximité de l'établissement ; les
données piézométriques mesurées dans un puits proche ; le débit d'un cours
d'eau suivi à l'aide d'un débit-mètre assez simple à réaliser (ces informations
sont évidemment plus faciles à collecter en zone rurales). Les prélèvements et
analyses bactériologiques ainsi que les dosages qui correspondent aux mesures
de qualité (température, pH, conductivité, O2 dissout, nitrates, tH, etc.), sont
réalisés classiquement en TP avec divers instruments ; des enquêtes peuvent être
réalisées auprès des élèves sur la consommation d'eau, par exemple ; les
échantillons d'eaux commercialisées en bouteilles sont accessibles à tous. Les
données recueillies seront en général de faible volume et se prêteront aussi bien
à une analyse manuelle ou à un traitement informatique.
D'autres données peuvent être acquises auprès des organismes gestionnaires
suivant leurs domaines de compétence. Plus fiables et plus représentatives des
situations régionales et nationales, ces données quantitatives et qualitatives
seront généralement importantes en volume. Depuis quelques années, leur
informatisation est devenue systématique, mais toutes les données historiques
ne sont pas encore resaisies sur des supports magnétiques. La plupart de ces
données sont accessibles au public (elles sont de fait confidentielles dans
certains cas).
1. Le B R G M dispose d'une banque de données géologiques importante,
qui contient 260000 fiches d'identification portant sur les
forages, puits, etc. effectués en métropole et Départements d'Outre Mer,
depuis le 18° siècle. A chaque fiche correspond un dossier de données. La
banque comporte des procédures de tri qui permettent d'obtenir rapidement les
références des dossiers recherchés.
GEOBANQUE,
2. Les services de la Météorologie nationale, par exemple, fournissent les
données climatiques journalières sur support informatique (fichier A S C I I )
depuis 1949, pour 20 paramètres et pour 160 stations. Cela représente une
source de données très intéressante car complète, le seul inconvénient est le
prix (13 Francs le paramètre/ an/ station).
3. Les agences de l'eau ont rassemblé et mis sur support informatique des
données provenant des différents organismes travaillant sur la gestion des
ressources en eau. Les données disponibles concernent la qualité et la quantité
des eaux superficielles, et la qualité des eaux souterraines.
L'ensemble de ces données sont manipulables sans problèmes majeurs avec
les logiciels généraux dont on dispose maintenant.
C. Les d o c u m e n t s d'appuis
Ils sont nombreux et contribuent à bien cadrer les problèmes posés et les
relier à des réalités concrètes :
- les cartes géologiques, hydrologiques, les images de télédétection,
- les normes et directives de qualité nationales et européennes, documents de
référence de l'OMS, etc.,
- les synthèses nationales et régionales périodiques : l'Etat de
l'Environnement, par exemple,
- les thèmes fournis par l'actualité qui donnent lieu à documents de presse
ainsi qu'à des articles dans les revues scientifiques (numéro spécial de La
Recherche sur l'eau, par exemple).
D. Les orientations de travail
A l'aide de l'ensemble de ces instruments et documents, il est possible
d'utiliser l'informatique de manière intégrée au déroulement normal de
l'enseignement, en respectant à la fois les contenus et l'esprit des programmes
actuellement enseignés dans les lycées.
Bien entendu, l'utilisation de ces aides est nécessaire pour la résolution de
problèmes biologiques et géologiques et ne constitue pas une fin en soi. L'élève
comme l'enseignant doit, dans un premier temps, se familiariser avec les outils
pour en explorer les fonctionnalités et en apprendre les modes opératoires
avant d'être capable de s'en servir efficacement.
Cet objectif ne peut pas être atteint si le nombre des logiciels à manipuler est
important. Ceci nous a incités à baser les activités proposées sur un nombre
limité de logiciels (un intégré, un cartographeur, un logiciel de représentation
graphique en 3D).qu'il est souhaitable de trouver réunis dans un seul, ce qui
paraît devoir se réaliser à court terme. Il est indispensable également de
disposer d'un logiciel ayant des fonctions simples de traitement statistique :
c'est l'outil du professeur pour réaliser une étude plus fine des corrélations
entre facteurs, mais les fonctions utiles peuvent également être trouvées dans
certains logiciels généraux (comme Excel).
Ces logiciels ne sont pas spécifiques de l'hydrogéologie ; tous les élèves
auront probablement à les maîtriser parce qu'ils serviront dans les diverses
disciplines. Il convient de prendre en considération plutôt les fonctions que les
noms des logiciels cités dans la mesure où ceux-ci évoluerons ou seront
remplacés par d'autres au cours des prochaines années.
Notre approche repose sur des exemples locaux. Ainsi, Les données météo
que nous utilisons concernent la station de Poitiers pour les années 1974-1987
et ont été acquises auprès de la Météorologie Nationale ; pour la même
période, les données hydrogéologiques concernant les qualité et quantité des
eaux superficielles, la qualité des eaux souterraines, nous ont été fournies
gracieusement par l'Agence de l'eau Loire-Bretagne. Mais s'attarder sur des
particularismes régionaux serait réducteur. Aussi, il est souhaitable que chacun
puisse disposer d'instruments similaires à ceux qui nous ont servi pour traiter
les données qui lui paraissent les plus adaptées à sa région, où le problème de
l'eau peut se poser avec une acuité ou en des termes différents.
En nous référant aux utilisations que nous avons testées, les thèmes de travail
avec les élèves sont répartis dans trois dossiers qui correspondent à des
interrogations majeures :
- les besoins et usages de l'eau,
- les flux d'eau et leur gestion,
- l'eau et les flux de matière.
Nous avons essayé de mettre systématiquement en évidence les sources
auxquelles on peut s'adresser pour obtenir des données régionalement
pertinentes.
II. L E S B E S O I N S E T U S A G E S D E L'EAU
A. Thème d'étude : alimentation en eau potable,
organisation des unités de distribution.
1. Objectifs pédagogiques
Ce thème introductif permet d'une part, de cerner les caractéristiques de la
région, et d'autre part d'initier les élèves aux logiciels nécessaires.
a - Problèmes à étudier :
- Quels sont les différents besoins et usages de l'eau ?
- Où est localisée la ressource ?
- Quelles sont les conséquences en termes de qualité et de volumes ?
- Quels sont les problèmes et leurs solutions ?
b - Savoirs :
- Définir : alimentation en eau potable (AEP), aquifère, nappe phréatique,
nappe captive, source.
- Nommer : les différents usages de l'eau, les besoins en eau, les principaux
problèmes locaux liés à l'eau, les principales localisations des ressources en
eau.
- Décrire : le devenir des eaux de pluies connaissant les propriétés des
roches du sous-sol.
c - Savoir faire :
- Extraire les informations significatives d'un texte.
- Repérer les paramètres d'un problème.
- Collecter des données.
- Etudier quelques variables descriptives d'une série de données.
- Formuler un problème.
2. Collecte et saisie des informations
a - Organismes compétents :
La diversité des besoins et des usages de l'eau, ainsi que la localisation de la
ressource font intervenir des organismes publics, sous la tutelle de plusieurs
ministères, et des entreprises privées.
- Les Directions Régionales des Affaires Sanitaires et Sociales (DRASS) et les
Directions Départementales des Affaires Sanitaires et Sociales ( D D A S S ) sont
chargées du contrôle sanitaire des eaux destinées à l'alimentation en eau
potable, ainsi que du contrôle des traitements des eaux usées. Elles dépendent
du Ministère de la santé.
- Les Directions Départementales de l'Equipement (DDE) sont chargées de la
gestion des ressources en eau en milieu urbain, et de la gestion de l'eau des
rivières domaniales jusqu'à une profondeur de 40 mètres. Leurs compétences
sont parfois déléguées aux services techniques de la ville. Elles dépendent du
ministère de l'Equipement.
- Les Directions Départementales de l'Agriculture (DDA) et leurs Services
Régionaux d'Aménagement des Eaux (SRAE) sont chargés de la gestion des
ressources en eau en zone rurale, jusqu'à une profondeur de 40 mètres. Elles
dépendent du Ministère de l'Agriculture.
- Le B R G M est compétent pour les ressources en eau situées à une
profondeur supérieure à 40 mètres. Il dépend du Ministère de l'Industrie.
- Les services techniques de la ville sont chargés de l'approvisionnement en
eau de la cité, des contrôles de qualité des ressources, des traitements à
effectuer. Ils ont obligation d'informer le public (Journal Officiel de 1979).
- Les syndicats communaux et intercommunaux sont chargés de
l'approvisionnement en eau des communes, ainsi que des contrôles de qualité et
des traitements.
- Les organismes privés peuvent être chargés de la distribution de l'eau.
- Les Agences de Bassin sont des organismes financiers qui agissent par le
biais de subventions et de pénalités. Ils définissent une politique de l'eau,
constituent des banques de données, effectuent des traitements statistiques.
b - Données :
Carte numérisée montrant les unités de distribution ; fichier de qualité
(cf. IV). La distribution de l'eau destinée à l'alimentation en eau potable fait
intervenir les captages, les communes et les unités de distribution. Le captage
est le lieu où la ressource est prélevée, c'est un puits, un forage, un lac, une
retenue de barrage. Ce captage alimente les habitants d'une zone géographique
: c'est l'unité de distribution ( U . D . ) , la qualité de l'eau y est homogène. Une
commune peut être une U.D., ou appartenir à des U.D. différentes.
Des aménagements sont effectués pour la distribution, prenant en compte le
volume de la ressource et sa qualité ce qui rend le schéma précédent un peu
simpliste.
Une U.D. peut-être liée à plusieurs captages, soit pour des questions de débits
propres à chacun, soit pour effectuer des mélanges d'eau, quand un ou
plusieurs paramètres dépassent la norme. C'est le cas des nitrates : l'eau d'un
captage pauvre en nitrates est utilisée pour diluer l'eau du captage principal
excédentaire en ces ions.
Les U.D sont de petites taille quand il existe une ressource locale, l'U.D. étant
souvent confondue dans ce cas avec la commune. Ce schéma tend à disparaître
dés lors que des mélanges d'eau deviennent nécessaires : L'U.D. est étendue à
plusieurs captages, et regroupe plusieurs communes. Les U.D. sont de grande
taille quand la ressource locale est inexistante ou insuffisante. Plusieurs
communes sont alimentées par un même captage, l'eau est importée.
c - Logiciels :
- un cartographeur,
- un gestionnaire de fichiers,
- un tableur-grapheur.
Le principe de la cartographie est le suivant : un lien est établi entre un
captage, donc une analyse d'eau, et une unité de distribution définie sur la
carte. Selon la valeur du paramètre, la surface représentant l'U.D. prend une
teinte foncée quand la valeur est élevée, une teinte claire quand la valeur est
faible. Chaque U . D . doit être liée à une analyse d'eau. Si l'une d'elles est
absente, l'U.D. restera blanche. Les données numériques sont importées du
fichier de qualité. Les informations utiles à la résolution d'un problème par les
élèves seront placées dans la feuille de calcul du tableur.
3. Traitement de l'information
On dispose de beaucoup d'informations : données concernant l'origine de
l'eau : eau souterraine ou eau superficielle, eau importée ou captée sur place,
nature géologique de l'aquifère pour les eaux souterraines, du sous-sol pour les
eaux superficielles. Il faudra choisir les classes de paramètres à représenter :
ici, chaque paramètre constitue une classe (cf. annexe 2).
Les cartes obtenues traduisent par des trames ou des gris les classes définies
dans le traitement. Les constats porteront sur les comparaisons des cartes
obtenues, ils déboucheront sur la formulation d'hypothèses explicatives
intégrant les connaissances locales du terrain.
Les figures 1, 2, et 3, montrent un exemple de résultats et de conclusions
établis dans les Deux-Sèvres.
Fig. 1.- Origine de Veau distribuée pour l'alimentation en eau potable. Les
deux grandes unités de distribution du Nord du département des Deux-Sèvres
utilisent de l'eau superficielle captée dans deux lacs artificiels.
y
y
*
J
Ntaléon
^
L o s
A
u
b
y-y.
^
i
Thouars \
•
^
\Petit£ Boissière
Taizé • >
>
J^jSt Jouiri
/
• de Manies
yAvaillës " /
Lac du Cébron
X
:
/
La Chapelte
St Laurent
\
'
\
Le Caillou
• :
^
AutSïgrié/—
\ " / Thenez^y
V
A
• u_%
w <y
\
La^Peyrçite
UTPçyraite
:
y/
Parthenày--" " )^*v>
\...^\
•i . A
\ Lac de Mcrvcnt r""'^p^ouxi
/
N
Coulongeï
0 ,
X ™ .•^^-v
St/ompain -
//)
N
St Hilaire
la Palltidi , •
Le ^
e
,
?
/">
. c-w^
\ Chatrfây/
:
^
°
f
^
^
M
M
e
C
\>
S
St Etienne,
x
*av leBrulé ;
u
Pampt-oux
• . ^
-
x
b J l l e s
Fressines :
'
-
\
St Komany
Rdmany ••
St
•,>'st GénarcL,^. '
j x f>,
.; •A)y/m
TniouV •
° •••Vemoux
_ ; <
" \
• ....Jcîiizé
\
w
A
: A?
/X
"-Ca Crèche'
• La Fo>e^-^-^ okr
^nrjouHi,6eauVo.r
^nfjoulta .Beauvoir
/^Reffanes^
:
y
y~'^ ^
^.Clussais
"
/ La Ferrière
• i
\ .y*
y'
•
\• C^ay
r
"f \
^
SauzÔVaussais
la C i g o g n e - ^ V < . ^ ^ l o •u--'\Goujnay
^ ^ ^ - . .,
-Chef BouWhe , :y"' . •
;
V i l l i e r s ^ ^ ^ ^ ^ ^ ^
6
v
/
Lorgné
Crèxjères/
yy\..
Couturé •../
d'Argens"ôn
{
Fig. 2.- Localisation
des unités de distribution
de l'eau destinée à
l'alimentation en eau potable dans les Deux-Sèvres. Les U.D. sont nombreuses
dans le Sud et le Nord-Est du département. L'eau est captée dans les nappes
acquifères. Les deux U.D. du Nord-Ouest correspondent aux communes à soussol imperméable, alimentées par des retenues collinaires.
Fig. 3.- Nature de Vacquifère pour les eaux souterraines ou du sous-sol pour
les eaux superficielles. Les grandes U.D. correspondent aux terrains primaires
imperméables et la ressource en eau n'y est pas abondante. Les U.D. du Sud et
du Nord-Est sont sur des terrains calcaires, perméables, la ressource en eau est
constituée par les nappes aquifères.
III. L E S F L U X D ' E A U E T L E U R G E S T I O N
f
A. Objectifs pédagogiques communs aux différents thèmes d étude
1. Problèmes à étudier
- Que deviennent les eaux de pluie ?
- Quelles sont les différentes sorties de l'eau ?
- Quelle est l'origine de l'eau évacuée par les rivières ?
- Où sont situées les réserves d'eau ?
- Peut-on évaluer le volume d'eau stocké ?
- Est-il possible de gérer les flux d'eau ?
- Quelles sont les périodes de stockage d'eau dans les nappes ?
2. Savoirs
- Mise en évidence d'un flux, et du fonctionnement du système étudié
(aquifère, ruissellement...).
- Mise en évidence des variations de ce flux dans le temps :
- variation du débit, décharge d'une nappe,
- identification d'un décalage entre les variations de débits et celles de la
pluviométrie,
- mise en évidence d'une différence entre la cause et l'effet en fonction
des saisons (période hivernale et période estivale),
- notion de période de recharge d'une nappe.
3. Savoir-faire
L'élève doit résoudre un problème posé à l'aide d'informations brutes
(données météo, débits et niveaux piézométrique). Les savoir-faire mis en
oeuvre s'appliquent à tout travail de recherche :
- Faire des choix : identifier les éléments du problème, définir une stratégie
de recherche, choisir les paramètres à utiliser, la période à explorer.
- Acquérir des données (pour une étude utilisant des données
expérimentales) : définir la zone à étudier, effectuer des mesures, saisir les
données et constituer un fichier informatique.
- Mettre en relation les paramètres : choisir un mode de représentation
approprié et produire les documents utiles.
- Conclure : dégager des faits nouveaux, fournir des hypothèses
explicatives, définir les informations supplémentaires nécessaires pour tester
les hypothèses avancées.
Pour répondre au problème posé, l'élève peut disposer :
- de la banque de données contenant le ou les fichiers complets. Cela conduit
à développer toute la recherche,
- des feuilles de calcul (de type tableur) contenant les données (utiles et
inutiles) pour l'étude du problème pour une période déterminée,
- des feuilles de calcul contenant les données nécessaires à l'étude du
problème, et d'une stratégie de recherche,
- des feuilles de calcul contenant les données nécessaires à l'étude du
problème, d'une stratégie de recherche et des modes de représentation
appropriés (type de graphique, carte, calculs, statistiques, etc.).
Ces niveaux de difficulté peuvent constituer une graduation dans
l'apprentissage des différents savoir-faire, ou permettre la mise en oeuvre
d'une pédagogie différenciée en fonction des acquis méthodologiques de chacun
des élèves.
B. Collecte et saisie des informations
1. Organismes compétents
a. Données concernant les débits :
Les débits journaliers sont mesurés au niveau d'une station de jaugeage,
gérée par différents organismes. La plupart de ces stations sont gérées par le
Service Régional d'Aménagement des Eaux ( S R A E ) , d'autres le sont par le
Service Hydrogéologique Centralisateur (SHC). D'autres services peuvent être
concernés selon les régions.
Les Agences de Bassin collectent toutes les données concernant les débits, qui
constituent une banque informatisée. La répartition des stations de jaugeage est
variable d'une région à l'autre, certaines sont en cours d'aménagement,
d'autres ne sont plus en service. Les données concernant les débits sont donc
parfois incomplètes. Un travail de décompactage et d'organisation des données
est nécessaire (cf. annexe 3).
b. Données piézométriques :
Ce sont les D D A qui sont chargées d'effectuer les relevés concernant le
niveau des nappes. Plusieurs piézomètres sont suivis quotidiennement.
Cependant, les données ne sont disponibles le plus souvent que sur support
papier. Des projets sont en cours concernant la mise en place de piézomètres
accumulant les données dans une mémoire dont le contenu serait ensuite
récupéré par un ordinateur.
c. Données météorologiques :
La météorologie nationale fournit des fichiers sur support magnétique, pour
chacune des 160 stations de la métropole depuis 1949. Vingt paramètres sont
disponibles :
- températures extrêmes : mini et maxi
- précipitations : hauteur et durée de jour, de nuit, totale,
- insolations : durée le matin, le soir, totale,
- vent : force et direction des vents maxi instantanés et moyennes,
- humidité extrêmes : mini et maxi,
- évaporation piche,
- calcul des degrés jour,
- ETP.
Les stations météorologiques locales fournissent des données sur support
papier ou sur support magnétique. Un travail de décompactage et
d'organisation de ces fichier est nécessaire pour en améliorer la lisibilité avant
de pouvoir les utiliser. Les données climatiques concernent des relevés
journaliers, sauf pour l'ETP donnée mensuellement. Les paramètres les plus
utiles pour l'étude sont :
- les débits journaliers en m3/sec, m3/jour/km2, en mm
- la pluviométrie en mm, en m3/jour/km2.
- l'ETP mensuelle en mm.
2. Logiciels
Un gestionnaire de fichiers si l'information est fournie sur support
magnétique ; un tableur grapheur qui permet de saisir les informations
contenues sur support papier ou de récupérer les données triées dans le
gestionnaire de fichiers, de réaliser les opérations de calcul et la représentation
graphiques.
C. Les T h è m e s d ' é t u d e
1. Thème : mise en évidence d'un flux et de ses variations
a. Exemple d'acquisition et d'utilisation de données expérimentales
Le problème posé au départ repose sur le fonctionnement d'un système,
caractérisé par des entrées (pluviométrie), des sorties (débits, ETP, pompages)
et du stockage (fissures, aquifère). Les paramètres pris en compte dans cette
étude concernent la pluviométrie et la hauteur de la nappe. Leur mise en
relation doit permettre d'étudier les flux d'eau dans un système absorbant.
- Données locales :
Mesures quotidiennes de la pluviométrie, mesures quotidiennes du niveau du
toit de la nappe dans un puits ; choisir un site de mesures dans les environs de
l'établissement ou bien chez un élève ou enseignant dont le domicile se trouve
situé sur le bassin versant étudié. Il y a lieu de bien identifier les sites de
prélèvements pouvant exister sur ce bassin. Le niveau d'eau dans un puits est
mesuré à l'aide d'un détecteur ou d'un autre moyen ; le pluviomètre est installé
à proximité du puits à un mètre de hauteur, et dans un lieu sans arbre dans un
périmètre de quelques mètres. L'exploration d'une période dont la durée sera
comprise entre 400 et 800 jours, ce qui correspond à un cycle minimum, est
indispensable.
L'acquisition de données locales pose le problème de l'incertitude de la
mesure et de la validité des relevés aux erreurs près (possibles dans le cas de
nombreux expérimentateurs). L'exploitation des données devra tenir compte de
ces erreurs. La démarche est conventionnelle : choisir un mode de
représentation, mettre en relation les données, etc.
- Résultats :
Les graphiques créés montreront les variations de niveau de la nappe et
celles de la pluviométrie. Les hypothèses explicatives seront basées sur la
recherche de causalités s'appuyant sur les constats établis et destinées à décrire
le fonctionnement du système.
Des documents peuvent compléter les résultats et contribuer à une meilleure
interprétation :
- sorties du système : ETP, débit de rivière, pompage, pratiques culturales,
- paramètres climatiques : température, ensoleillement, vent, etc.,
- pratiques industrielles,
- données géologiques : propriétés physico-chimiques du sol.
La figure 4 montre un exemple de résultats et de conclusions concernant une
nappe du bassin de l'Auxances (86).
Û 7 7 7 I I I I I I 3 I 3 < < < 3 1 J - , -
?
- I 7 7 7
<
< < B
B
| ) ) O O O Z Z Z Û Û Û
' n
Evou
l to
i n modèsilée
n
n n m t
Evolution réele
Janvier
Fig. 4.- Evolution de l'eau dans un puits de fin décembre 1990 à début
janvier 1992 . Graphique du haut : données de pluviométrie et de niveau de
l'eau réellement mesurées. Graphique du bas : mise en place d'un modèle.
L'évolution
du niveau d'eau théorique dans le puits traduit bien le
changement du fonctionnement du système à partir de la mi-avril. Le système
fonctionne en stockage avant cette date, il déstocke après.
b. Travail à partir de fichiers de données professionnelles
- Choix du lieu :
La mise en relation de paramètres climatiques et de débits (et
piézométriques) impose de choisir un bassin versant bien délimité, ayant peu de
communications avec les bassins limitrophes, comprenant une station
météorologique et une station de jaugeage (une station piézométrique si les
données sont significatives de l'état de la nappe du bassin avant la station de
jaugeage).
Des informations relatives à la géologie, aux pratiques agricoles et
industrielles, aux aménagements effectués (barrages, stations de pompage)
seront collectées pour maîtriser les entrées et les sorties du système étudié.
La comparaison de deux bassins versants permettrait de généraliser et
relativiser les observations précédentes, d'identifier les constantes et les
variables de fonctionnement. Une schématisation du fonctionnement d'un
bassin versant peut être envisagée.
- Données : débits, météorologiques, piézométriques.
Il faut disposer de données journalières pour observer les variations
significatives, dont la durée varie entre 24 et 48 heures (et parfois moins de 24
heures). Comme dans le cas précédent, il est indispensable d'explorer une
période dont la durée sera comprise entre 400 et 800 jours.
Plusieurs périodes de cette durée peuvent être extraites des fichiers. Leur
utilisation est double :
- chaque groupe d'élèves peut travailler sur une période particulière.
La synthèse des résultats permettra de tester le domaine de validité des
conclusions,
- un groupe d'élèves pourra tester ses hypothèses en les éprouvant sur
d'autres périodes.
- Traitements :
Le choix d'une unité commune est indispensable pour faire une étude
comparative entre les entrées et les sorties d'un système, et entre différents
systèmes. Les hydrogéologues utilisent des litres/seconde/km2. Les débits
exprimés en m3/seconde, les précipitations et l'ETP exprimés en mm seront
convertis avant d'être utilisés.
- Résultats :
Les graphiques créés montreront les variations de débit et de pluviométrie.
Des graphiques complémentaires, utiles pour la résolution du problème,
présenteront l'ETP, et les variations de hauteur de la nappe si elle existe.
Les comparaisons entre les entrées et les sorties que traduisent les débits, et
l'ETP permettront d'établir les constats.
Les figures 5, 6, et 7, montrent les résultats obtenus et les conclusions
dégagées pour la Sèvre Niortaise (79).
Débits et Pluviométrie
en m3/Jour/Km2
6(K)(K)-i
Fig. 5.- Variation comparée des débits de la Sèvre Niortaise et de la
pluviométrie, exprimés en m '/jour/km . Du 15 octobre au 15 mars, un épisode
pluvieux est suivi, 36 à 48 heures après, par une augmentation du débit. Après
le 15 mars, les précipitations ne provoquent qu 'une augmentation faible voire
nulle du débit. La Sèvre représente le comportement d'une rivière en système
absorbant.
3
2
mm d'eau
300 T
Fig. 6.- Evolution annuelle de la pluviométrie et de l'ETP en mm. La période
estivale est caractérisée par une pluviométrie faible et par une forte
évapotranspiration potentielle. Pendant cette période, les sorties sous forme
d'ETP sont supérieures aux précipitations.
Fig. 7.- Schéma du fonctionnement du bassin de la Sèvre Niotaise à partir
des données des figures 5 et 6. C'est un phénomène cyclique constitué de deux
phases distinctes '.pendant la période hivernale il y a reconstitution des stocks
dans les nappes et le flux implique sol et sous-sol. Pendant la période estivale,
les nappes d'eau alimentent les rivières, l'importance de l'ETP limite le flux
d'eau au sol et à l'atmosphère.
2. Thème : la gestion des flux d'eau
Après la mise en évidence de la nature du système et de sa dynamique, le
problème posé ici porte sur les bilans. Peut-on évaluer le volume des entrées et
des sorties d'eau ? Peut-on avoir une estimation du volume d'eau stocké dans
l'aquifère ?
La gestion des ressources en eau en est à ses débuts. Les organismes chargés
de ces bilans font des approximations importantes (un bilan est estimé équilibré
avec une différence de 30% entre les entrées et les sorties). En fait, la gestion
des ressources en eau repose actuellement sur la connaissance empirique du
terrain par les hydrogéologues. La prudence dans ce domaine s'impose, les
conclusions dégagées poseront davantage de problèmes qu'elles n'en
résoudront.
- Traitements :
Les données et les outils sont ceux définis précédemment.
Les valeurs concernant les débits, les précipitations et l'ETP sont exprimés en
litres/sec/km2 ou m3/heure/km2.
Un cumul de chaque donnée sera ensuite effectué : Cumul (J) = débit (J) +
Cumul ( J - l ) . Ces cumuls concernent les opérations suivantes : Pluviométrie ETP ; Pluviométrie - (ETP+Débits).
Les cumuls traduisent le volume d'eau qui entre et qui sort du système
pendant la période considérée ; ils privilégient la tendance générale en
atténuant les variations.
- Résultats :
Les graphiques représentent les courbes de Pluviométrie et de Pluviométrie(ETP+Débits). Les comparaisons entre l'état initial et l'état final du stock, ses
variations au cours de l'année constitueront les premiers constats. Si la
pluviométrie et les débits sont bien connus, leur mesure est précise, l'ETP en
revanche est calculée. Cette valeur ne représente qu'une approximation. Les
sorties du système prises en compte négligent les pompages en rivière ou dans
la nappe, ainsi que les échanges possibles entre les bassin versants. Une bonne
connaissance du terrain est donc nécessaire et doit guider le choix des bassins à
étudier.
Les figures 8 et 9 montrent un exemple de résultat et de conclusions
concernant un bilan annuel et une évolution des stocks dans le bassin de la
Sèvre Niortaise (79).
ENTREES
Pluviométrie
ETPE3
Débits
Nappes |
Fig. 8.- Bilans annuels des entrées et des sorties d'eau, et estimation de l'état
du stock pour le bassin versant de la Sèvre Niortaise en amont du pont de
Ricou.
Sèvre N i o r t a i s e
kn^/jour/km
2
Cumul de pluviométrie
Fig. 9.- Evolution du stock pour le bassin de la Sèvre Niortaise. C'est à la
mi-février que se produit l'inversion de la tendance : avant, le stock augmente,
après il diminue. L'état du stock est déficitaire par rapport à l'état pris comme
référence fin 1987. L'une des données est approximative : l'ETP est calculée et
non mesurée. Cependant, la différence observée est suffisamment
importante
pour penser que le bassin a perdu de l'eau.
IV. L ' E A U E T L E S F L U X D E M A T I E R E
f
A. Objectifs pédagogiques communs aux différents thèmes d étude
1. Problèmes à étudier
La qualité de l'eau est un sujet d'actualité abordé régulièrement par les
médias. Posés en terme de pollution et de potabilité, les problèmes concernant
la qualité des eaux sont variés :
- Quels sont les paramètres qui décrivent la qualité d'une eau ?
- Quelles sont les eaux soumises à une réglementation ?
- Qu'est-ce qu'une eau potable ?
- L'eau qui est distribuée dans telle commune est-elle potable ?
- Qu'en est-il pour les autres communes de la région ?
- Les eaux commercialisées en bouteilles sont-elles conformes aux normes de
potabilité ?
- Comment mesure t-on la qualité d'une eau ?
- La qualité d'une eau varie-t-elle au cours de l'année ?
- Quels sont les liens entre la qualité de l'eau et le milieu où elle est
prélevée ?
2. Savoirs
- Nommer les types de paramètres qui décrivent la qualité d'une eau.
- Donner la valeur de la norme de qualité pour les paramètres vulnérables.
- Nommer des paramètres influant sur la qualité de l'eau, les causes de
pollution.
- Relier la qualité de l'eau au cycle de la matière : origine des substances
solubles et insolubles, nature et impact des activités humaines, rôle du
dioxygène et des micro-organismes.
B. La collecte des informations
1. Les paramètres de qualité
La qualité de l'eau exprime sa potabilité : c'est la vocation première des
analyses effectuées. Cette vision est cependant restrictive. Si les normes de
qualité pour l'alimentation en eau potable (AEP) sont connues, celles concernant
les eaux superficielles et les eaux usées le sont moins.
Les résultats d'une analyse constituent aussi un bilan ponctuel des interrelations entre l'eau, solvant, et le ou les milieux traversés apportant les
solutés. Les analyses physico-chimiques et bactériologiques traduisent l'origine
de l'eau, son histoire, les pratiques humaines locales, etc.
- L'eau potable : les normes de potabilité
Les limites de qualité des eaux destinées à la consommation humaine
concerne les paramètres organoleptiques, physico-chimiques et microbiologiques, des paramètres relatifs aux substances indésirables, toxiques,
pesticides et produits apparentés. La norme française en vigueur repose sur la
norme européenne. Si elle doit se conformer aux minima fixés, elle peut
aggraver les limites pour certains paramètres. Le J.O du 4/01/1989 définit les
limites, et plusieurs dispositions délimitant les compétences des organismes
chargés de sa mise en application.
Pour les eaux en vente dans le commerce, plusieurs dénominations sont
utilisées : les eaux de source n'ont pas subi de traitement, et sont conformes à
la norme européenne ; les eaux de table sont conformes aux normes mais après
un traitement ; les eaux minérales dépassent les normes pour un ou plusieurs
paramètres et devraient être qualifiées d'eaux médicinales.
- Les eaux superficielles
La qualité de ces eaux est définie par le type d'utilisation, la minéralisation
et la qualité générale de l'eau.
- Les eaux rejetées
Une norme fixe la qualité minimale d'un rejet d'eau à dominante
domestique. Néanmoins, elle n'est pas toujours mise en application.
2. Organismes compétents
Ce sont avant tout la Direction Départementale des affaires sanitaires et
sociales ( D D A S S ) ou la Direction Régionale des affaires sanitaires et sociales
( D R A S S ) chargées par voie réglementaire de la surveillance de la qualité des
eaux destinées à la consommation humaine et les organismes chargés du
prélèvement de l'eau destinée à 1' Alimentation en Eau Potable (AEP). D'autres
analyses sont effectuées par le Service Régional d'Aménagement des Eaux
(SRAE), les fédérations de pêche.
La D D A S S (ou la D R A S S ) intervient pour la qualité de l'eau destinée à la
consommation humaine et par extension aux animaux et à l'environnement. Ses
attributions sont fixées par le Journal Officiel du 4 / 0 1 / 1989. Elle effectue les
prélèvements et mesure la qualité de l'eau à tous les niveaux : ressources et
distribution de l'eau potable ; avant et après traitement pour les eaux usées.
Sur demande de services, elle fait un diagnostic et cherche les causes des
dégradations. Elle est en liaison avec la D D A qui est chargée de la police des
eaux, et collabore avec l'Agence de Bassin qui agit par l'intermédiaire de
primes ou de pénalités. Les prélèvements et les analyses d'eau sont effectués
par le laboratoire de la D D A S S . Il y a plusieurs types d'analyses :
- Type 1 : analyse complète (coût : 2600 F en 1990) bactériologique,
physico-chimique complète, et éléments indésirables (métaux, pesticides),
- Type 2 : analyse physico-chimique simple et bactériologique,
- Type 3 : analyse bactériologique seulement.
La fréquence annuelle des analyses dépend de la population et de la
vulnérabilité de la ressource : en milieu rural, avec une population inférieure à
1000 habitants : 2 "type 2" et 8 "type 3" ; pour une population de 50 000
habitants : 52 "type 2" et 208 "type 3". Les données sont souvent sur support
papier. L'informatisation des DDASS est en cours.
D'autres organismes travaillent sur la qualité : le SRAE effectue des analyses
pour dresser une carte globale de la qualité des eaux superficielles. A partir de
ce constat, il peut définir une politique d'aménagement. Le Conseil supérieur
de la Pêche effectue les analyses sur demande des fédérations. Cet organisme
collabore avec le S R A E . Les Agences de Bassin sont en relation étroite avec
tous les organismes chargés de l'eau. Elles possèdent les résultats des analyses
de qualité sur support informatique. Ces fichiers peuvent être fournis
gracieusement ou facturés.
C. Le t r a i t e m e n t des informations
1. Les données
Le fichier de qualité représente la source principale de l'information, à
partir de laquelle les analyses et les paramètres utiles seront sélectionnés, triés,
exportés. Complétée tous les ans, l'information s'y accumule, elle est
consultable par quiconque est à la recherche d'une information. Ce double
aspect d'écriture et de consultation devra être défini en termes d'accès et de
protection des données. Les fichiers informatisés doivent être préparés pour
l'utilisation. Réaliser un fichier informatique à partir d'un fichier papier
présente l'inconvénient de la saisie, mais cela ne concerne qu'un nombre
réduit de fiches (une centaine par an).
a. Choix des paramètres
Le fichier contiendra les analyses de tous les captages de la zone
géographique servant dans l'étude, sur une ou plusieurs années. Pour chaque
captage, certains paramètres peuvent être qualifiés d'obligatoires. D'autres
paramètres seront ajoutés à cette liste, en fonction de l'intérêt qu'ils
représentent localement.
b. Présentation du fichier
Les fiches reprennent la classification utilisée par la D D A S S . D'autres
modèles de présentations peuvent être établis. Des fiches ne montrant que
certains paramètres offrent un accès simplifié à l'information, une présentation
sous forme de liste se révèle utile pour visualiser tous les captages et les
paramètres répondant à une requête.
2. Les logiciels
- Un gestionnaire de fichiers,
- un tableur-grapheur orienté statistique : seront en particulier utilisés les
courbes, les nuages de points et le coefficient de corrélation, en coordonnées
polaires,
- un cartographeur : il permet de montrer la variation géographique d'un
paramètre. Il utilise pour cela des données importées du fichier de qualité, et
une carte numérisée des U.D. (déjà mentionnés dans le premier dossier).
D. Les t h è m e s d ' é t u d e
1. Thème : étude des normes de potabilité à partir des fichiers de qualité
Chaque fiche de qualité regroupe les résultats d'une analyse d'eau. La
consultation du fichier se fait grâce à des requêtes permettant la recherche, le
tri et le classement des fiches, ce qui doit permettre de répondre à quelques
questions comme :
- Quelle est la qualité de l'eau distribuée dans ma commune ?
- Quelles sont les analyses qui, pour un paramètre donné, dépassent la
norme ?
a. Traitements
Le nombre de fiches est généralement assez important (de 100 à plus de
1000), et pour chacune beaucoup de paramètres sont disponibles. La
consultation du fichier ne peut pas se faire sans avoir défini au préalable la
nature du problème à étudier. Deux domaines d'utilisation peuvent être
dégagés : connaître la qualité de l'eau d'un captage et ses variations dans le
temps, et connaître la qualité des eaux pour un paramètre donné (nitrates,
microbiologie, etc.).
- Résultats :
La recherche fournit les fiches entières qui peuvent être imprimées. Si elle
porte sur un paramètre, le résultat utilisera un modèle de présentation
fournissant la liste des captages et leur descriptif correspondant à la requête.
Les constats porteront sur les comparaisons des fiches obtenues avec les
normes de qualité des eaux. La mise en relation des constats effectués et des
connaissances locales du milieu pourra déboucher sur la formulation
d'hypothèses explicatives ou de nouveaux problèmes.
Les figures 10 et 11 montrent quelques exemples d'exploitation des fichiers
concernant la qualité de l'eau dans les Deux-Sèvres.
Commune
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
MENIGOUTE
Dénomination
Les Héraudières
Les Héraudières
Les Héraudières
Les Héraudières
Les Héraudières
Les Héraudières
Les Héraudières
Les Héraudières
La Bourronnière
La Bourronnière
La Bourronnière
La Bourronnière
La Bourronnière
La Bourronnière
La Bourronnière
La Bourronnière
La Bourronnière
Date
4/19 32
10/19 32
3 .'1983
12/19 33
5/19 34
11 /19 34
4/19 35
10/19835
4/19*32
10/19832
3/198 3
12/19853
4/198 4
5/19854
11/198 4
4/198 5
10/198 5
pH
Cond
207
7, 1 260
207
6,8
6,6
245
6,9
246
5,3
205
7,4
284
6, 3 198
350
7,2
7 2 444
307
6,8
7,4
440
7, 1 393
369
7,1
6,7
270
271
6,6
7,5
503
6,7
N03
1", 1
19, 4
19
18, 3
19,2
22 , "
2^,3
19,6
3 0,1
37,2
29, 1
35,8
3 0,5
30,5
36, 1
24, 4
40,4
TH
8
13,2
10,4
9,6
14,8
10,3
12, 4
8
17,2
24,4
18
24,8
18,7
20,8
14
12,4
25 2
Bact totales
8
330
29
600
1
200
64
300
24
50
20
170
33
300
71
80
116
Fig. 10.- Analyses d'eau effectuées entre 1982 et 1985pour la commune de
Ménigoute (79) (10 000 habitants). Le modèle de présentation montre la valeur
de quelques paramètres de qualité. Cette commune est alimentée par deux
captages, chacun faisant l'objet d'une analyse semestrielle par la DASS.
Cconine
AIFFRES
AMURE
AMURE
LA-BATAILLE
LA-BATAILLE
BEAUVOIR
BEAUVOIR
LE-BOURDET
LE-BOURDET
BRIOUX
BRIOUX
LES-FOSSES
COULON
COULONGES
COULONGES
ECHIRE
ECHIRE
FORS
FORS
FORS
FORS
LA-FOYE-MOLA-FOYE-MOGRANZAY
GRANZAY
LUSSERAï
LUSSERAY
MAUZE
MAUZE
PAS-DE-JEU
LA-PEYRATTE
PRIN-DEYRPRIN-DEYRST-GELAIS
STHILAIRE-LASTHILAIRE-LA
ST-MAXIRE
ST-MAXIRE
ST-POMPAIN
ST-POMPAIN
Dénomination
AIFFRES
LA-GORRE
LA-GORRE
PUITS-NORD-BOURG
PUITS-NORD-BOURG
LA-GRAVETTE
LA-GRAVETTE
LA-JEANNERIE
LA-JEANNERIE
LA-FONZEE
LA-FONZEE
PRE-RIVIERE
MANTE
TOURTERON
TOURTERON
LA-COUTURE-Pl
LA-COUTURE-Pl
LE-PONTREAU
LE-PONTREAU
LA-CHAUVINIERE
LA-CHAUVINIERE
VALLEE-DU-PEROT
VALLEE-DU-PEROT
LE-PERRAULT
LE-PERRAULT
FONTAINE
FONTAINE
RICHEBONNE
RICHEBONNE
GRANDS-CHAMPS-F2
BOURG
LES-FONTAINES
LES-FONTAINES
PUITS-DU-BOURG
MAZ
MA.Z
PERIGNY
PERIGNY
STE-SABINE
STE-SABINE
Nitrates
53,2
74,5
67,3
53,7
53,1
63,3
65,9
78,4
72,1
56
55
128,1
50,3
58,3
65,2
66, ~i
64,4
53,5
50,^
50,3
69,3
77,3
86,5
59,3
53,?
55
53,3
50,5
50
£0,3
52, 4
"5,7
"'l, 3
59, 1
91,3
34,3
50
51,5
59, ~
Btage
Jurassique-moyen
Jurassique-supérieur
Jurass ique-supérieur
Jurassique-supérieur
Jurassique-supérieur
Jurassique-supérieur
Jurassique-supérieur
Jurassique-supérieur
Jurassique-supérieur
Jurassique-supérieur
Jurassique-supérieur
Jurassique-supérieur
Jurassique-moyen
Jurassique-moyen
Jurassique-moyen^
Jurassique-moyen
Jurassique-moyen
Jurassique-supérieur
Jurassique-supérieur
Jurass ique-supérieur
Jurassique-supérieur
Jurassique-supérieur
Jurassique-supérieur
Jurassique-supérieur
Jurassique-supérieur
Jurassique-moyen
Jurass ique -noyer.
Jurassique-supérieur
Jurassique-supérieur
Jurassique-moyen
GRANITE
Jurassique-supérieur
Jurassique-supérieur
Jurassique-moyen
Jurassique-supérieur
Jurassique-supérieur
LIAS
LIAS
Jurass ique-moyen
Jurassique-moyen
Fig. 11.- 53 analyses d'eau sur les 257 effectuées en 1985 dans les DeuxSèvres excédaient la norme de potabilité pour les nitrates. C'est l'un des
paramètres sensibles dans ce département. Les captages concernés sont
principalement dans les terrains calcaires et Jurassiques
2. Thème : qualité d'une eau et répartition géographique
Plusieurs problèmes vont pouvoir être étudiés à l'aide de la cartographie :
- quelle est la valeur d'un paramètre de qualité dans les communes du
canton ? du département ?
- quels sont les liens entre qualité et milieu ?
- la qualité de l'eau de chaque commune varie t-elle dans le temps ?
Les données seront exportées du fichier de qualité. Chaque U.D. sera
représentée par une analyse : il faut identifier une U.D. à un captage, puis
définir la période à représenter pour éviter que plusieurs analyses effectuées à
des dates différentes ne soient sélectionnées. Le semestre semble indiqué, car il
correspond à la fréquence d'analyse des captages en zone rurale. En zone
urbaine, la période peut-être plus courte. Les paramètres à extraire du fichier
de qualité concerneront la géologie, la pollution, etc. Le choix de certains
paramètres dépend des conditions locales. La D D A S S peut fournir des
informations utiles sur les paramètres surveillés localement.
a. Traitements
La répartition des valeurs concernant un paramètre va faire l'objet d'un
découpage ayant pour but la définition de classes de valeurs. L'utilisateur
choisit :
- le nombre de classes, qui doit concilier la précision et la lisibilité. Un
nombre élevé favorise la précision au détriment de la lisibilité ; le compromis
se situe entre 4 et 6 classes.
- les limites de classes, qui conditionnent la cartographie. La carte
obtenue avec les mêmes valeurs sera différente selon les limites définies. Le
cartographeur propose plusieurs méthodes statistiques destinées à guider
l'opérateur. Il semble judicieux de définir pour chaque facteur des limites
basées sur des classes équidistantes.
Exemples :
pH :
Nitrates (mg H ) :
6,5
25
7
50
7,5
75
b. Résultats
La carte obtenue traduit la classe à laquelle appartient chaque U.D. Une
légende complétera la carte, ainsi que quelques données statistiques décrivant la
répartition de la population : moyenne, écart type, minimum et maximum.
Les constats seront issus de la comparaison des cartes obtenues traduisant la
répartition géographique d'un paramètre, les changements de sa répartition
selon les périodes de l'année, les paramètres ayant la même répartition. Les
hypothèses explicatives seront basées sur les connaissances locales. Des
corrélations pourront être établies avec la géologie, les pratiques agricoles,
l'activité industrielle. Le flux de matière peut être appréhendé.
Les figures 12, 13, 14, 15, et 16 montrent des exemples de cartographies
traduisant des états et des évolutions de quelques paramètres de qualité pour les
Deux-Sèvres.
Fig. 13.- Concentration des ions magnésium exprimée en mgll La norme est
de 50 mgll. Les concentrations sont toujours inférieures à le norme. La
répartition de cet ion ne coïncide pas avec celle du calcium. Son origine doit
être recherchée dans les dolomies et dans les terrains métamorphiques.
De 94.40 à 74.85
De 74.85 à49.88
1
:j De 49.88 à 2 5 . 1 6
De 2 5 . 1 6 a 0 . 7 0
Moyenne = 38.14
Ecart-<ype = 19.72
Mnimum = 0.70
Maximum = 94.40
Discrétisation selon les seuils observés
Fig. 14.- Concentration en nitrates exprimée en
sont souvent proches de la norme ou la dépassent.
peut être corrélée avec la géologie du sous-sol
proviennent des apports azotés pour les cultures de
calcaires du Sud et du Nord-Est.
mgll Les
concentrations
La répartition de cet ion
(cf. fig. 3). Les nitrates
céréales dans les plaines
Fig. 15.- Conductimétrie en micro-Siemens par centimètre. Les eaux du
Nord-Ouest sont douces et peu minéralisées. Celles du Sud et du Nord-Est sont
dures et minéralisées.
Fig. 16.- Bactéries totales début 1985. La qualité est très variable d'une U.D.
à l'autre. La contamination bactérienne est élevée pour les ressources en eaux
superficielles et, ponctuellement, pour certaines eaux souterraines. Dans ce
dernier cas, les causes de vulnérabilité doivent être recherchées dans les
activités situées dans le bassin d'alimentation de la ressource. Le nombre de
bactéries est en général plus élevé dans le deuxième semestre,
situant
l'influence des températures estivales dans la prolifération des bactéries.
3. Thème : qualité et potabilité d'une eau : représentation en coordonnées
polaires
C'est une représentation graphique par secteurs, chaque axe représente un
paramètre de qualité. Cette technique de représentation permet d'apporter une
réponse rapide aux problèmes liés à la qualité et à la potabilité d'une eau. Les
données sont fournies par les étiquettes des eaux commercialisées en bouteille.
- Traitements
Les paramètres représentés sont sélectionnés en fonction de leur disponibilité
et de leur importance locale pour la potabilité de l'eau. Chaque axe possède la
même échelle, alors que les paramètres ont des valeurs et des unités
différentes. Chaque paramètre sera donc exprimé par une unité qu'il faudra
définir. Le regroupement des paramètres par secteurs nécessitera la définition
d'une stratégie d'exploitation.
- Résultats
Le graphique obtenu traduit la qualité de l'eau pour le captage et les
paramètres choisis. Si le grapheur ne propose pas la légende automatique,
chaque point sera identifié sur la périphérie du cercle. Un coloriage de la
partie interne améliore la lisibilité.
Chaque graphique fournit une "signature" de la qualité de l'eau. Les eaux
ayant des signatures proches peuvent rapidement être regroupées et des
familles constituées : eaux potables et non potables, eaux ayant des
minéralisations voisines, etc. Les hypothèses explicatives reposeront sur les
liens entre la valeur des paramètres et l'origine de l'eau.
La figure 17 montre les résultats obtenus avec quelques eaux distribuées en
bouteille.
Contrexeville
Fig. 17.- Analyse d'eaux
Vichy St Yorre
minérales.
Contrexeville et Vichy St Yorre sont très minéralisées et dépassent les
normes de potabilité pour un ou plusieurs paramètres. Ce sont des eaux
médicales, leurs étiquettes expriment les avantages et les contre-indications.
Perrier et Evian sont peu minéralisées et tous les paramètres sont
inférieurs aux normes.
nettement
4. Thème : corrélations entre paramètres de qualité des eaux
Il s'agit ici de conduire une approche analytique de l'état de l'ensemble des
paramètres de qualité de l'eau, dans un secteur géographique, pendant une
période donnée. Par l'étude des corrélations entre paramètres de qualité, c'est
la formulation d'hypothèses explicatives qui constitue l'objectif final. Elles
doivent permettre de comprendre le lien existant entre la qualité d'une eau et
son milieu.
Le choix des données repose en partie sur les particularismes locaux. Les
industries, les villes, le type d'activité agricole, la géologie du sous sol vont
rendre sensibles des paramètres différents. Il est donc nécessaire de prendre
connaissance des conclusions dégagées par la D D A S S pour effectuer ce choix.
Mais tous les paramètres ne se prêtent pas à ce travail, faute de
connaissances sur le sujet. D'autres paramètres, non concernés par la norme
européenne, sont intéressants à étudier car ils constituent des "marqueurs"
géologiques. Ce sont les ions calcium, magnésium, fer, sulfates, potassium, la
silice, et certains paramètres physiques : le tH, la conductimétrie, le pH, le %
de dioxygène dissout. La liste n'est pas exhaustive.
- Traitements
La qualité de ce travail repose sur le traitement d'un nombre important de
données pour une période déterminée. Prendre un paramètre de référence
(pouvant être différent pour les groupes de la classe) et étudier sa corrélation
avec chacun des autres paramètres. La corrélation sera établie en étudiant la
forme du nuage de points et/ou en examinant le coefficient de corrélation. Une
bonne corrélation se fait à 0,9, le seuil se situe à 0,75.
Les paramètres seront classés en trois groupes : paramètres corrélés avec le
paramètre de référence, paramètres corrélés mais dont l'évolution est inverse,
paramètres non corrélés avec le paramètre référence.
- Résultats
Dans le cas où une stratégie a été établie pour se partager le travail, une
synthèse collective sera nécessaire. Corrélation ne signifie pas lien de cause à
effet. Les corrélations établies seront accompagnées d'hypothèses explicatives
chaque fois que ce sera possible. Les connaissances sur le milieu, les autres
sources d'information, la confrontation d'hypothèses différentes peuvent
contribuer à l'élaboration d'une réponse satisfaisante associant certitudes et
interrogations.
Les figures 18 et 19 montrent l'exploitation d'un fichier de qualité des eaux,
et les corrélations établies entre le paramètre "calcium" et les autres
paramètres de qualité dans les Deux-Sèvres.
Fig. 18.- Les nuages de points et les coefficients de corrélation indiquent une
bonne corrélation entre le calcium et le TH le TAC, HCOf, et une assez
bonne corrélation avec les nitrates et la silice.
f
Fig. 19.- Synthèse des corrélations entre le calcium et et les
paramètres de qualité. Trois groupes de paramètres apparaissent :
autres
- Le groupe constitué par les nitrates, la conductimétrie (Cdt), le TAC, le
TH et HCOf ont une bonne corrélation avec le calcium ; ils évoluent dans le
même sens.
- Le groupe de la silice évolue en sens inverse du groupe précédent,
corrélation avec le calcium est cependant moyenne.
la
- Le dernier groupe est constitué par les autres paramètres (Bact : bactéries,
Sat O2 : saturation en dioxygène) dont les variations ne semblent pas liées à
celle du calcium.
V - CONCLUSIONS
Créer des activités reposant sur l'emploi de l'informatique implique la
définition de la spécificité des outils utilisés. L'intérêt d'une banque de données
réside dans le volume d'informations contenu, accessible à tout moment mais
pour des besoins différents. Exploiter ces informations suppose une
connaissance précise de ce qui est cherché : quelle est la question posée ? Quel
est le problème à résoudre ? Suit un inventaire des éléments nécessaires : de
quoi j'ai besoin ? Enfin, une stratégie de recherche doit être élaborée :
comment je trouve ? L'élève doit analyser la situation, faire des choix, trier les
données, effectuer des traitements, choisir un mode de représentation, élaborer
des conclusions ou des hypothèses explicatives. Lorsque l'élève reçoit, en TD,
un document papier où figurent pratiquement tous les éléments nécessaires à la
résolution d'un problème, ce travail est déjà réalisé.
Les contacts avec le monde professionnel nous ont permis d'évaluer toute la
richesse des connaissances que l'on peut dégager des banques de données dont
l'existence constitue souvent une condition indispensable pour la
compréhension d'un certain nombre de problèmes. L'initiation méthodologique
des élèves (et des enseignants) concernant ce type d'approche est en adéquation
avec les méthodes modernes d'investigation et constitue donc un acte de
formation important pour l'éducation scientifique.
Le traitement d'un volume parfois très important de données recueillies n'est
réalisable qu'en utilisant des logiciels de traitement et de représentation
graphique. S'approprier un logiciel dépend principalement de la qualité de
l'interface utilisateur. Sans restreindre la puissance du logiciel, les interfaces
actuelles (Mac OS, Windows) permettent de s'affranchir des codes clavier et de
la gestion des fichiers et répertoires, pour privilégier le choix, la pertinence et
le développement d'une stratégie d'exploration. Libérée des contraintes
purement techniques, l'attention de l'élève ou du groupe se centre sur le
problème biologique à résoudre, l'exploitation des informations, la
formulation d'hypothèses amenant à de nouvelles connaissances et conclusions.
Ce type de travail pose cependant le problème du temps nécessaire à sa mise
en oeuvre (pour l'apprentissage technique et méthodologique). L'état initial de
la banque de données peut moduler la difficulté du travail : les élèves peuvent
disposer de la totalité des données (niveau difficile) ou seulement d'un volume
restreint quelques données pertinentes pour un objectif limité (niveau facile),
avec tous les intermédiaires possibles selon les fichiers constitués. Il n'en reste
pas moins que, comme cela a été souvent constaté, proposer aux élèves des
activités individuelles améliore l'attrait et la richesse de l'apprentissage, mais
nécessite un temps supérieur à celui requis par la communication directe des
résultats.
Le tableau 1 montre un exemple de progression pédagogique sur le thème
des ressources en eau, pratiquée en classe de seconde.
Références
- Aide à la décision Collection CXP 5 rue Monceau 75008 Paris. Description de 148 logiciels.
1989.
- Mathématiques, statistiques et dépouillement d'enquêtes. Collection CXP 5 rue Monceau
75008 Paris. 1989.
- Agences de Bassin Publications trimestrielles.
- SRAE Poitou Charentes (1988) Schéma d'aménagement des eaux du bassin du Clain.
- CRDP de Poitiers : Etude du bassin versant de la Charente (1989).
- OMS : Directives de qualité pour l'eau de Boisson (3 volumes). En vente à la Librairie Arnette
2 Rue Casimir Delavigne. 75006 Paris.
- J. Bodelle et J. Margat (1980) L'eau souterraine en France Paris Masson.
- G. Castany (1982) Principes et méthodes de l'hydrogéologie Paris, Dunod Université.
- D. Champiat et J.P. Larpent (1988) : Biologie des Eaux Méthodes et techniques. Paris,
Masson.
- Laboratoires MERCK-CLEVENOT (1986) : Manuel de microbiologie L'analyse de l'eau 5 à 9
rue Anquetil BP 8 94130 Nogent sur Marne.
Annexe 1
Logiciels professionnels spécialisés
et logiciels généraux
Logiciels réalisés par le BRGM
- ACTIF : Saisie d'informations de forages et valorisation immédiate sous la forme de compte
rendu d'exécution ou de coupes techniques et lithologiques,
- ISAPE : Interprétation semi automatique des pompages d'essai, simulation du comportement
des puits dans des contextes hydrogéologiques variés,
- DEFI : Conception des forages d'eau assistée par ordinateur,
- MADO : Module d'acquisition de données,
- IMAGE : Calcul d'inférence entre puits,
- GARDENIA : Modèle global à réservoirs pour la simulation des débits et des niveaux
aquifères,
- MARTHE : Modèle hydrodynamique tridimensionnel pour les calculs en milieux poreux,
- PIPER : Caractérisation chimique globale des eaux issues d'un aquifère,
- VAL : Modèle de simulation des aquifères
- INGRID : Interpolation dans un maillage et visualisation,
- SYNERGIE : Planification et cartographie assisté par ordinateur.
Logiciels établis p a r I G A
- D E S C A R T E S Modélisation : Ensemble de modules de saisie, de traitement et de
représentation de données (courbes de niveau, en 3 Dimensions) de tout système z=f (x,y)
- HYDROSIS : logiciel de traitement de mesures de niveau d'eau et de suivi de captage
- IGA-SONDEL: logiciel d'interprétation de sondages électriques rapide et simple.
- IGA-DIGIT : logiciel de calcul de surfaces de périmètres, longueurs, orientations et
coordonnées à partir d'une table à digitaliser. Le calage est réalisé par la méthode des moindres
carrés.
- DIGI-DEG : logiciel de digitalisation de coordonnées en longitude et latitude exprimées en
degrés, minutes et secondes. Le calage est réalisé par la méthode des moindres carrés pour un
repère non norme.
- IGA-VLF : ensemble de modules permettant de digitaliser un plan de position de profils de
mesures VLF, d'en saisir les mesures et de les représenter sur traceur.
Logiciels généraux
-
Gestionnaires de fichiers : File Maker Pro, 4 D (Mac), Dbase, SuperBase.
Tableurs-grapheurs : Excel 4.
Grapheurs : Criketgraph, Deltagraph.
Cartographeurs : Carto 2D (Mac), Map Maker, cartes et Bases.
Logiciel orienté statistiques : Stat view (Mac).
Intégrés : Ragtime (Mac), Works.
Gestionnaires de fichiers intégrant l'hypertexte : Hypercard (Mac), Tool Book.
A
N
N
E
X
n
° 2
Fichier brut
Eaux Souterraines : Qualité
E
O B J E T : Décrire la structure du fichier brut et les traitements à effectuer pour le
rendre utilisable.
Structure d u Fichier brut :
LISTE DES CAPTAGES DE LA VIENNE
NUMERO
NOM DE LA COMMUNE
CAPTAGE D'IMPLANTATION
LIEU DIT
COOR. LAMBERT
Y
X
8600401
8600601
8600602
8600603
REMERLE
GUE DES SIOUX 1
GUE DES SIOUX 2
GUE DES SIOUX 3
487,14
487,23
487,23
487,23
ANGLES / ANGLIN
ANTIGNY
ANTIGNY
ANTIGNY
190,03
174,90
174,90
174,90
| PARAMETRES DE LA QUALITE DE L'EAU
! COL1
! COL2
: COL3
| COL4
! COL5
COL6
! COL7
| COL8
COLS
i COL 10
j COL 11
j COL12
: COL1 3
i COL 14
1
NUMERO DU CAPTAGE
DATE DE L'ANALYSE
TURBIDITE EN GOUTTE DE MASTC
PH
OXYGENE CEDE EN MG/L
DURETE (TH) EN °F
T . A C EN °F
AMMONIUM EN MG / L
NITRITES EN MG / L
CONDUCTIVITE EN MICRO-S / CM
NITRATES EN MG : L
CHLORURES EN MG / L
SULFATES EN MG / L
FER EN M G / L
I DONNEES
COL1
COL9
COL2
COL 10
COL 3
COL 11
C0L4
COL 12
COL5
COL 13
COL6
COL 14
COL 7
COL8
8600401
0000,00
8600401
0000,00
8600401
0000,00
760106
0452,28
760430
0452,28
760810
0481,46
0888,00
0010,00
0888,00
0005,00
0888,00
0005,00
0007,10
0020,00
0007,00
0024,00
0007,60
0022,00
0000,40
0000,00
0000,60
0005,00
0001,10
0005,00
0025,10
0000,10
0024,60
0000,01
0036,20
0000,01
0023,40
0000,00
0023,40
0000,00
0026,00
0000,00
—
A N N E X E
Fichier brut
Eaux superficielles : Quantité
n°3
O B J E T : Décrire la structure du fichier brut, et les traitements à effectuer pour le
rendre utilisable.
Structure d u Fichier brut :
HYDRO
AN JOUR 12 DEBITS
L211401981
1011600040100151108400034000555012200 5600
L211401981 2012600374009150076500422004690011300
5400
L211401981 3013400395001151067500785004370018300
4900
L211401981 4088500995009950060500870004660014800
4000
L211401981 5073500107107500058000980004260013900
3200
000 001 2 7 6 1 0 4 8 0 0 A
000 0001 5 0 1 0 4 3 5 0 A
000 00011 6103700A
000 000100103400A
000 000900003180A
7200 1700 000 000660005650A
L211401981 280317005550086500520007300037900
7200 1600 000 000600009700A
L211401981 290464009998071000505007750010110
1400 0 0 0 3 8 0 0 5 4 0 0 0 1 4 9 1 A
L211401981 30037600999805950049500145101181064000
L211401981 311046809998084000999806150099980
0009998134710999802741A
6900
L211401981 1029610775005350030700 4300
000 000 000 0 0 0 000 19003110A
L211401981 2 0 2 1 9 1 0 7 3 0 0 0 7 5 5 0 0 3 0 7 0 0 4000
000 000 000
000 000 4002870A
Origine d u fichier :
Organisation des données
A : agriculture
S : service hydrologique centralisateur
L : agence Loire-Bretagne
Code hydrologique de la station : de 1 à '
Année : de 8 à 10 (3 derniers jours)
Jour : de 11 à 12 12 débits (5 caractères par débit), de janvier à décembre ; de 13 à 72
L211401 981; j 10116000401001511084000340005550) 2200 5600! 000
001 276104800 A
3 chiffres pour le débit
Codage d ' u n débit :
1 caractère de qualité :
0 ou blanc pour un débit bon,
1 ou 2 pour un débit douteux,
9 quand la qualité n'est pas exprimée,
4 pour un débit provisoire.
-f00340<
1 caractère pour la puissance
9998 : Jours inexistants 11 9999 : Débit manquant
L21140198129046400
L2114019813003760C
L2114019813110468C
L21140198132Q5ROOC
L211^10198133 Î4212Ô41027Ô1Ô850Ô03553101471016Ô10
Ligne 32 : Effiits moyens mensuels
000600009700A
800540001491A
02741A
6OOOOGÔ358ÎO3441043Ô&A
tïfeae 33 : Débits maximaux instantanés
Annexe
Météo : Données archivées
n°4
OBJET : Description de la banque de donnée et analyse pédagogique de son utilisation en Collège ou Lycée .
Organisme créateur : Météorologie nationale SCEM/ CLIM/ R
Serveur:
2 Avenue RAPP 75340 PARIS Cedex 07
Tel:16.1.45 46 73 57
D o n n é e s sur s u p p o r t i n f o r m a t i q u e
Fichier : ASCII sur disquette 5 1 / 4
Logiciels pouvant les utiliser : Tout logiciel acceptant un fichier ASCII
Configuration nécessaire : Tout micro ordinateur
Coût : Environ 13 FF pour un paramètre an
Données disponibles :
Les données météo sont disponibles pour 160 stations,depuis 1949.
20 paramètres sont disponibles :
-températures extrêmes: Mini et maxi
-précipitations: hauteur de jour, totale, nuit et durée de précipitation de jour, totale
-insolations: durée insolation du matin, durée insolation du soir, durée insolation totale
-vent: force et direction des vents maxi instantanés et moyennes et les heures
-humidité extrêmes: mini et maxi
-évaporation piche
-calcul des degrés jour
-ETP
Fichier METEO brut
O B J E T : Décrire la structure du fichier brut, et les traitements à effectuer pour le
rendre utilisable.
Structure d u Fichier brut :
296740101+005+0160810980000
296740102-003+0070790939998
296740103-024+0890610950010
296 74 01 01 +005 +016 081 098 0000
296740104+029+1140520969998
T° Min
296740105+064+1130540910048
T° Max
Humidité Min
1
Précipitations
Humidité Max
296740106+063+1130650909998
296740107+073+1390610960006
9QA7^im O R - L H / L R - I - I
1 £0770070089
NATURE ET TAILLE PU FICHIER ;
C'est un fichier ASCII, il couvre les années 1974 -1987 pour les paramètres décrits ci-dessus.
Sous forme compactée et en ASCII, il occupe 150 Ko environ.
TRAITEMENT PU FICHIER
Décompactage
Ce travail a été réalisé à l'aide d'un gestionaire de base de données, chaque fiche correspondant
à un enregistrement. La séparation des paramètres est réalisée à l'aide des fonctions textes propres au
logiciel. La taille du fichier obtenu est de l'ordre de 1 Mo. L'importation a duré 45 minutes (Sur Mac+
et File Maker).
Opérations sur le fichier :
Les données manquantes sont codées -99 ou -999. Il faut alors faire une recherche de ces données et les remplacer par un blanc.
Pour la pluviométrie, le code 9998 signifie sol sec et pas de pluviométrie, le zéro signifiant sol
humide et pas de pluviométrie. Cette distinction nous est apparue peu significative pour l'exploitation , les données codées 9998 ont été transformées en 0.
REAUSATIQN D'UN FICHIER P E TRAVAIL;
Ce fichier est réalisé à partir du précédent, en ne copiant que les valeurs numériques obtenues.
Disparait ainsi le fichier de base, et toute possibilité de modification de ces valeurs. En outre, la taille
du fichier obtenu est considérablement réduite : 490 Ko.
Un fichier ASCII doit-être produit pour être importé par le logiciel utilisé lors d'une étude ou
ces données sont exploitables. ( C'est un fichier aux applications multiples) .
OUTILS UTILISES
+
Compatible PC AT, Processeur 80386 et coprocesseur arithmétique
+ Framework 3
Nature de
l'activité
TD:
L'eau,
sujet
un
nouveau
d'actualité
Objectifs
de savoir
Objectifs
de savoir-faire
j -Définir : AEP,
j - Nommer :
. les différents usages de l'eau, \ Extraire les éléments significatifs,
. les besoins en eau.
i Faire une synthèse
. les principaux problèmes
\ locaux liés à l'eau.
Définir : aquifère, nappe phréa-i Lire une carte avec des courbes
tique, nappe captive, source
j d'isovaleurs.
Les ressources en Nommer : les principales loca-i Représenter une nappe sur une
eau
! lisations des ressources en eau, j coupe géologique.
Répartition
et
Décrire : le devenir des eaux de
pluies connaissant les propriétés
localisation
des roches du sous-sol.
- Définir : nappe phréatique, \ Mettre en relation des
TD:
nappe captive, milieu absorbant, informations.
Les ressources en milieu ruisselant,
- Nommer : les périodes où uneEtablir une relation de causalité.
eau
Extraire des informations d'un
nappe se recharge
Variations
- Décrire : le devenir d'une eau graphique.
de pluie en milieu absorbant
quantitatives
TP:
TP:
Mesure
de
quelques
de
paramètres
qualité
de
l'eau.
Normes
de
qualité
- Définir : Paramètre de qualité, Utiliser correctement le matériel.
Norme de qualité, dureté, pH,
Respecter les consignes
conductivité, solutés.
d'utilisation
des réactifs
- Nommer : les principaux
paramètres de qualité de l'eau
destinée à la consommation
humaine.
- Définir : qualité de l'eau, Norme de potabilité
La qualité de l'eau - Décrire : le lien entre la
Utiliser un fichier informatisé,
dans
nature du sous sol et la variation
de quelques paramètres de
le
département
qualité.
des
Deux-Sèvres
L'origine des nitrates dans l'eau
TP:
- Décrire : le lien entre la
nature
du sous sol et la variation i
La qualité de l'eau
Utiliser un outil de représentation
de
quelques
paramètres de
dans
cartographique
qualité.
le
département
TP:
Tableau 1 : Organisation d'une progression pédagogique réalisée en classe de seconde
T r a m e d e l'activité
| Quels sont les problèmes liés à la qualité de Veau. ?
\ Etude d'un article de presse locale par un groupe. Elaboration d'une synthèse écrite (maximum 10 lignes).
i Mise en commun orale des articles étudiés.
j Enquête : volumes d'eau consommés par ménage. Définition des critères à relever.
\ Bilan : Les problèmes liés à l'eau dans le département.
I Où sont localisées les ressources en eau ? Peut-on identifier
les flux d'eau?
i Répartition des ressources en eau : étude de documents cartographiques concernant le département.
| Localisation des ressources : utilisation d'une carte hydrogéologique :
| Déterminer le sens des flux d'eau,
Représenter la nappe superficielle sur une coupe géologique concernant une partie de cette
carte.
Comment
varient les réserves d'eau d'une nappe ? Quelles en sont les causes ?
Etude d'une représentation graphique de données expérimentales concernant les variations
du niveau d'eau du puits et la pluviométrie.
Comment
varient les réserves d'eau d'une rivière ? Quelles en sont les causes ?
Etude d'une représentation graphique des débits d'une rivière du département, et de la
pluviométrie sur une période de 14 mois.
Comment mesurer la qualité d'une eau ^Mesure expérimentale de quelques paramètres
pH ( pHmètre), 0 2 dissous (oxymètre), Conductivité (conductimètre), Dureté totale
(bandelettes TH), Nitrates (bandelettes nitrates).
Chaque groupe mesure les valeurs de ces paramètres pour une eau dont il ignore l'origine.
Utilisation des normes de qualité des eaux naturelles et de la norme de qualité de l'eau
destinée à la consommation humaine.
Collecte des résultats :Au tableau pour critique collective : Quelle classe ? potable ?
Confrontation des résultats avec l'origine de l'eau étudiée (eau de rivière, eau minérale...)
i Présentation du fichier de qualité des eaux brutes, et des manipulations de base.
L'eau qui m'est distribuée est-elle potable ? Recherche des fiches concernant l'unité de
distribution de chaque élève du groupe (utilisation de l'index). Comparaison avec les normes, rédaction d'un bilan de qualité pour l'analyse imprimée.
Quels sont les captages qui ont fourni
une eau dépassant les normes de potabilité
pour
un paramètre ? Utilisation des fonctions de recherche critériées, de tri. Les paramètres
i étudiés sont ceux qui se sont dégagés de l'étude précédente (nitrates, bactéries,...). Bilan,
j Comment
varie un paramètre pour un captage ?
Liberté est laissée de choisir un paramètre, le captage. Dégager une conclusion globale.
Comment expliquer les variations géographiques
de la qualité de l'eau ?
Présentation du logiciel de cartographie.
Elaboration guidée d'un document cartographique. Détermination des classes de valeurs,
choix d'une méthode statistique.
Elaboration par groupe de représentations cartographiques concernant 2 ou 3 paramètres.
Elaboration d'une synthèse par groupe, puis collective (en cours).
GESTION DES RESSOURCES VEGETALES ET ANIMALES
Exploitation pédagogique des logiciels
professionnels d'aide à la décision
A. Barrère, J. Barrère, J.Y. Dupont, B. Moulia
Ce travail est dédié à Bernadette Moulia
L'équipe est particulièrement
redevable aux organismes suivants :
- Centre National d'Etude et de Recherche sur les Techniques Avancées (CNERTA)
- Chambre d'Agriculture d'Indre et Loire
- Institut des Techniques Céréalières et Fourragères (ITCF)
- Institut Supérieur Agricole de Beauvais (ISAB). Société ISAGRI
- Institut National de Recherche Agronomique (INRA). Station Avicole de Tours-Nouzilly
Travail réalisé dans le cadre d'une coopération entre l'INRP et l'iNRAP.
GESTION DES RESSOURCES VEGETALES ET ANIMALES
E x p l o i t a t i o n p é d a g o g i q u e des logiciels
p r o f e s s i o n n e l s d'aide à la décision
193
A. Barrère, J. Barrère, J.Y. Dupont, B. Moulia
I. L'INFORMATIQUE D A N S LE MONDE AGRICOLE
194
A. Les Logiciels disponibles
1. Production végétale
2. Production animale
B. La collaboration avec l'enseignement agricole
195
195
196
197
IL LOGICIELS CHOISIS. FONCTIONNALITES
ET UTILISATION PEDAGOGIQUE
198
A. Fertilisation minérale : le logiciel ISAFUMURE
1. Fonctionnalités
2. Utilisation pédagogique
a. Activités sur le terrain et en T.P.
b. Utilisation du logiciel
3. Les étapes du travail
a. Les exportations minérales
b. Les caractéristiques du sol
c. Amélioration de la fertilité des sol
198
198
199
200
200
201
201
202
205
B. Rationalisation de l'irrigation : le logiciel LORA
1. Fonctionnalités
2. Utilisation pédagogique
a. Les besoins en eau des plantes
b. Les réserves en eau du sol
c. L'adéquation besoins-ressources
205
205
207
207
209
210
C. Nutrition animale : le logiciel DIETAL
1. Fonctionnalités
2. La nutrition en vue de la production de lait
3. La physiologie des ruminants
4. Le rationnement en stabulation libre
a. La valeur nutritive des aliments
b. Equilibrer les apports alimentaires
c. Eviter le prélèvement sur le squelette
d. Accroître la production lactée
5. La nutrition en pâturage
a. L'évolution de la prairie dans le temps
b. La valeur alimentaire des fourrages
213
213
213
214
217
217
218
219
219
220
222
223
ni. SYNTHESE
224
ANNEXE
227
GESTION DES RESSOURCES VEGETALES ET ANIMALES
Exploitation pédagogique des logiciels
professionnels d'aide à la décision
La production végétale et animale est au centre d'enjeux considérables : son
évolution s'accompagne de mutations sociales importantes ; elle comporte une
dimension économique nationale et internationale de premier plan ; les
pratiques qui y sont utilisées ont des conséquences considérables sur les milieux
naturels. L'accroissement démographique et le développement industriel ont
amené à une mobilisation des esprits sur ce thème. Dans ce contexte, nous
avons choisi de mettre l'accent sur la compréhension des relations entre les
aspects fondamentaux et appliqués des sciences biologiques, d'une part, et sur
l'étude des des bases scientifiques de la gestion des écosystèmes naturels et
aménagés d'autre part. Cette gestion qui tient une grande place dans les
programmes d'enseignement constitue également une contribution essentielle à
la formation du citoyen.
Sous leurs aspects les plus tangibles, les contenus d'enseignement dans ce
domaine ont une valeur pédagogique particulière, dans la mesure où ils
appellent de nombreuses activités concrètes des élèves sur le terrain et au
laboratoire. Cette caractéristique est précieuse en classe de seconde où l'accent
doit être mis sur l'apprentissage de méthodes plutôt que sur l'accumulation de
connaissances spécialisées.
Mais l'enseignement de la gestion des ressources naturelles rencontre des
difficultés évidentes. Du fait que la recherche fondamentale et appliquée sont
très actives, celui-ci implique l'intégration régulière de nouveaux savoirs, ce
qui a pour conséquences l'augmentation en volume des contenus à enseigner.
De plus, la compréhension des relations entre les êtres vivants (dont
l'Homme) et leur milieu, et la place de ces relations dans le fonctionnement des
écosystèmes naturels et subventionnés appelle une approche systémique et
comporte beaucoup de concepts peu évidents qui appartiennent à divers
domaines (géologie, pédologie, biochimie, économie, etc.). Introduites de
manière progressive et étalée dans le temps, ces connaissances sont forcément
parcellisées et la dimension systémique devient assez difficile à appréhender.
En outre, comme dans beaucoup d'autres domaines de la biologie et de la
géologie, le renouvellement des connaissances est associé à l'emploi de
techniques d'analyse et d'investigation complexes qui ne sont pas praticables
dans un enseignement général. Pour toutes ces raisons, un enseignement de la
production végétale et animale basé sur les connaissances scientifiques et les
méthodes techniques les plus récentes requiert des outils pédagogiques
nouveaux. La référence aux utilisations de l'informatique dans ces domaines
peut fournir un certain renouvellement des méthodes d'approches et peut-être
même un certain approfondissement des concepts enseignés.
I. L'INFORMATIQUE DANS LE MONDE AGRICOLE
Dans les milieux professionnels, l'informatique joue un rôle croissant dans la
gestion et l'aide à la décision. Les logiciels utilisés à cette fin exploitent les
connaissances scientifiques actuelles, relient entre elles les données fournies par
l'utilisateur, les manipulent en fonction de modèles, produisent une expertise
qui éclaire les décisions. L'informatique a apporté très tôt des moyens de
stockage et de traitement de l'information. Depuis une douzaine d'années, on
constate une évolution de ses fonctions en milieu agricole :
- elle participe maintenant aux travaux de suivi (contrôles de performances
des animaux, résultats d'analyse de sol, etc.),
- elle constitue également un outil de prévision : le but est de mettre en
évidence un manque à produire lié à certaines pratiques ; on réalise donc,
compte-tenu de certains facteurs connus, une prévision de production
théorique ; la confrontation entre les résultats apparaissant dans le suivi et la
production théorique amène à déterminer des écarts,
- elle remplit enfin une fonction de diagnostic : il s'agit de trouver les causes
des écarts constatés et d'envisager les remèdes possibles ; ce diagnostic
débouche, au niveau de la gestion de l'exploitation agricole, sur la prise de
décision.
Cette introduction de l'informatique a modifié de manière assez importante
les modalités de cette prise de décision : de façon traditionnelle, on décidait au
niveau de l'exploitation en considérant un certain nombre d'informations
qualitatives ou quantitatives recueillies dans l'exploitation et valorisées à la
lumière de "l'expérience".
La manipulation de modèles de plus en plus complexes, conjuguée avec la
modification d'un certain nombre de normes (désignant les caractéristiques des
aliments par exemple) en rapport avec les connaissances scientifiques et
techniques, a entraîné un déplacement du lieu et des modalités de la prise de
décision.
L'exploitant met à la disposition d'un "spécialiste" les informations dont il
dispose (analyse de sol, historique parcellaire, aliments disponibles dans
l'exploitation, production laitière, etc.) afin que celui-ci lui procure en retour
des "conseils" de fumure, de complémentation alimentaire, à partir desquels il
décidera. Ceci se fait dans le cadre de structures (Chambres d'Agriculture,
coopératives de production, etc.).
Toutefois, un retour à la gestion individuelle est maintenant perceptible,
notamment à travers l'équipement en matériels informatiques d'exploitations de
production laitière. Ce fait est en rapport avec la nécessité d'un suivi en temps
réel de la production et des facteurs qui la régissent : la distribution
automatique de concentrés se fait en exerçant, pour chaque tête de bétail, un
contrôle journalier de l'alimentation qui est mise en rapport avec la production.
La saisie des informations est considérablement réduite et la décision peut-être
affinée si nécessaire.
A. L e s Logiciels disponibles
Les logiciels agricoles sont très variés dans les domaines qu'ils traitent :
cultures céréalières, fourragères, arboricoles, viti-vinicole, élevages bovins,
ovins, porcins. Certains sont généralistes (culture des céréales, par exemple),
d'autres plus spécialisés (ne concernant qu'une seule espèce). Ils sont aussi en
rapport avec les différentes fonctions de l'entreprise : optimisation des travaux
de la ferme, gestion économique, gestion de production. La fonction de
production est la seule qui nous intéresse ici. Tant en production animale que
végétale, les domaines d'application que nous avons repérés sont essentiellement
de trois ordres :
- la sélection des espèces et le choix des variétés,
- l'amélioration de la production en agissant sur les apports ou les pratiques,
- les traitements préventifs et curatifs (diagnostic et traitement en
pathologie).
Nous nous sommes intéressés aux logiciels disponibles qui relèvent des deux
premiers points (cf. annexe 1).
1. Production végétale
Parmi les logiciels en rapport avec la production végétale, nous avons
analysé les produits suivants :
- Les logiciels de l'Institut des Techniques Céréalières et fourragères (ITCF).
Nous avons travaillé d'abord sur les logiciels de la version 1986 ( V A R I T C F ,
DESHERBITCF, FONGITCF, AZOTICF) dont les fonctionnalités ont été ensuite
rassemblées dans un produit unique : FORMULE BLE.
Cette version de 1989, actualisée et complétée, répond aux problèmes
suivants : quelle variété de blé choisir en fonction de différents paramètres
(pédologiques, climatiques, biologiques, agronomiques) ? Quelle densité
semer ? Quel est l'objectif de rendement possible en fin d'hiver ? Quelle
quantité d'azote doit être apportée ? A quel moment ? Quand doit-on traiter ?
Avec quels produits ? Il s'agit typiquement d'un logiciel spécialisé.
- Trois logiciels qui traitent de la fertilisation minérale ( I S A F U M U R E , P L A N
F U M U R E et G E S T E R ) . Leurs finalités communes sont : effectuer une
interprétation d'une analyse de sol, calculer un bilan minéral à partir des
cultures réalisées, optimiser un plan de fumure. Ces produits prennent en
compte un nombre important de paramètres : P2O5, K 0 , Ca, Mg et dans
certains cas les oligo-éléments. Ils utilisent des modèles différents, fruits de la
recherche agronomique, et mettent en évidence que le sol de l'exploitation
agricole est fragilisé par les importantes exportations dues aux récoltes et doit
être rigoureusement géré par l'agriculteur.
DE
2
Les produits les plus anciens, ont des performances modestes et ne gèrent
qu'un problème particulier (exemple : optimisation d'une fumure azotée, choix
d'une variété de blé), ce qui implique pour chaque objectif la saisie d'un grand
nombre de données. A la faveur de l'apparition d'outils informatiques de type
gestionnaire de données, l'évolution s'est faite dans le sens d'une intégration des
différentes applications dans un même produit, en travaillant sur une même
base de données qui devient plus complète avec le temps. La prise de décision
se fait donc en prenant en compte une "histoire" (de la parcelle ou du
troupeau). Ainsi, A Z O T I T C F (conçu en 1980) proposait des conseils sur une
campagne agricole, alors que I S A F U M U R E (version de 1988) propose un plan
de fumure tenant compte du suivi de la parcelle sur plusieurs années.
La présentation de ces logiciels est également très différente : les plus récents
ont des menus déroulants, des représentations graphiques et des tableaux
préaffectés. Quoique également récent, Plan de fumure, élaboré par la chambre
d'agriculture de la région Rhône-Alpes, s'adresse particulièrement à des
techniciens : la saisie des données est longue ; il n'y a pas ou peu de tableaux
récapitulatifs des informations ; les résultats ne sont pas assortis d'explications.
2. Production animale
Parmi les logiciels en rapport avec la production animale, quatre ont été
analysés (MENUALI, ALIPORC, PORFAL, DIETAL). Ils ont un même objectif
global : optimiser une ration alimentaire afin d'assurer une production
maximale au moindre coût en ajustant au mieux l'alimentation aux besoins de
l'animal.
Ils sont différents par :
- les paramètres qu'ils prennent en compte : MENUALI ne considère que 8
caractéristiques alimentaires (la masse sèche, la valeur énergétique, 2
composants minéraux, etc.). DIETAL en considère 21.
- La précision dans les conseils qu'ils fournissent et dans la facilité avec
laquelle on peut créer des situations différentes. Exemple : dans M E N U A L I ,
l'indication du rationnement pour les vaches allaitantes est fournie pour trois
périodes ; dans DIETAL, cette indication est fournie semaine par semaine si on le
désire.
- Les contraintes à privilégier : M E N U A L I , ALIPORC et
optimisation d'abord en fonction de l'objectif de production.
contrainte "coût" une dimension prépondérante.
DIETAL
PORFAL
font une
fait de la
- La présentation, la convivialité et la forme de restitution des résultats : dans
la plupart des logiciels, les conseils pour une nouvelle situation nécessitent
l'entrée de nouvelles valeurs et la relance d'un nouveau calcul. DIETAL avec ses
menus déroulants, ses représentations graphiques en couleur et ses tableaux
préaffectés permet de lancer une simulation en indiquant seulement le ou les
paramètres à faire varier.
En conclusion, nous avons retenu I S A F U M U R E et D I E T A L à cause de leurs
caractéristiques techniques et de leurs performances. Les différences observées
par rapport aux autres produits sont liées à leur caractère récent et donc à une
meilleure connaissance des sols, des besoins des végétaux, de la composition des
aliments (l'exploitant fait dorénavant analyser son fourrage par exemple) et de
l'impact des différents composants alimentaires sur la physiologie de l'animal.
A ces deux produits il faut ajouter un troisième logiciel, L O R A , apparu en
cours de recherche. Il permet de choisir une culture, de lui attribuer une
surface sur l'exploitation agricole et d'adopter un mode de conduite de
l'irrigation. Il propose des solutions aux problèmes liés à l'amélioration de la
production primaire et à la gestion des ressources hydriques. Il complète
utilement l'approche introduite par le logiciel ISAFUMURE.
B. La collaboration avec l'enseignement agricole
Ces logiciels qui servent déjà dans la formation des professionnels ont
rarement donné lieu à une exploitation pédagogique dans l'enseignement initial.
Du fait qu'ils comportent une composante technologique importante, nous
avons essayé d'en cerner les apports possibles dans l'enseignement secondaire,
en collaboration avec un établissement d'enseignement agricole, le Lycée de
Tours-Fondettes.
Comme la plupart des établissement de ce type, l'enseignement s'y organise
autour d'une exploitation agricole très proche de celles existant dans la région,
c'est-à-dire orientée vers la polyculture (maïs, tournesol, blé, colza), l'élevage
(Bovins,Ovins) et l'horticulture. Il prend également un caractère expérimental
à travers quelques spécialisations : arboricole, orientée vers la production
fruitière, et viti-vinicole. Nous trouvons donc dans cet établissement des
spécialistes en phytotechnie et en zootechnie. Cette collaboration est intéressante
pour plusieurs autres raisons :
- les programmes d'enseignement de la biologie dans les classes de seconde et
de première sont semblables à ceux de l'enseignement général,
- il y existe les mêmes préoccupations d'ordre pédagogique, notamment en ce
qui concerne l'intégration de l'outil informatique compte tenu du grand
développement auquel on assiste actuellement dans ce secteur,
- il est directement impliqué dans des applications techniques et des activités
de recherche, et dispose de ce fait de nombreuses données.
- il est en rapport avec de nombreux organismes du domaine de la recherche
fondamentale et appliquée (INRA) et du domaine économique (Chambres
d'Agriculture),
- il dispose des productions logicielles diffusées par l'intermédiaire du
Centre National d'Etude et de Recherche sur les Technologies Avancées
(CNERTA) à un réseau d'établissements d'enseignement agricole.
II. L O G I C I E L S C H O I S I S . F O N C T I O N N A L I T E S
ET UTILISATION PEDAGOGIQUE
A. Fertilisation minérale : le logiciel I S A F U M U R E
1. Fonctionnalités
Ce logiciel aborde le problème de la fertilisation minérale : il interprète une
analyse de sol, calcule un bilan minéral à partir des cultures réalisées
(exportations) et des caractéristiques physico-chimiques du sol et optimise un
plan de fumure. Il présente quatre options :
a. Paramétrages : cette option permet de définir les caractéristiques générales
de l'exploitation cultures, parcelles, engrais et amendements.
b. Analyse de terre : cette fonction comporte toutes les informations relatives
à cette analyse, ainsi que les normes d'interprétation et les conseils régionalisés.
c. Prévisions : celles-ci portent sur les conseils de fumure ; la fonction
fournit toutes les informations qui permettent de formuler ces conseils à partir
des analyses de terre (assolement de l'année et prévisionnel sur les quatre
campagnes à venir).
Elle utilise notamment les plans de fumure issus des saisies précédentes. Le
logiciel recherche pour chacune des parcelles la meilleure association d'engrais
répondant aux paramètres enregistrés.
d. Réalisations : il s'agit de saisir les fumures effectivement épandues et les
rendements récoltés. Le logiciel calcule alors le bilan minéral de la parcelle.
S
I
A
F
U
i
M U R
E
PARAMETRAGES
G E S T I O N DE LA
FERTILISATION
Je
1
dênarre
1
2
3
4
Isafunure
ANALYSES
PraMétrages
2
Analyses
3
de
1
2
3
4
5
terre
Prévisions
4
Rëa1 i s a t i
Cultures
Parcel 1 es
Engrais
Divisions des
ons
DE
parcelles
TERRE
A n a l y s e s de
t e r r e
Conseils
régionalisés
Nornes d' i n t e r p r é t a t i o n
Interprétation
des
analyses
E d i t i o n des
analyses
PREUISIONS
1
2
3
4
5
6
A s s o l e n e n t de
l'année
Assolenent
prévisionnel
C o n s e i l s de f u n u r e P205
K20
C o n s e i l s d e f u n u r e C a O MgO
P l a n s de F u n u r e
optimises
P l a n s de f u n u r e s i nu l é s
REALISATIONS
1
2
3
4
Fig. 1.- Menu principal
FuMures
réalisées
Rendenents
récoltés
B i l a n de
funure
Changenent de
canpagne
dlsafumure.
Ces fonctionnalités s'appuient sur les résultats de la recherche (station
pédologique de l'INRA de Laon) qui a abouti à l'établissement de normes
d'interprétation prenant en compte la capacité du sol à retenir les ions nutritifs
K , M g , N H , C a , etc. (capacité d'échanges cationiques du sol : CEC) .
+
2+
+
2+
1
4
2. Utilisation pédagogique
Ces fonctionnalités s'intègrent bien dans les programmes de biologie. En
classe de seconde, elles permettent d'aborder les propriétés physico-chimiques
du sol, son dynamisme (exportations et restitutions, cycle de la matière), la
fertilisation organique et minérale ; elles conduisent à dégager les règles
qu'impose une fertilisation raisonnée.
1 La CEC ou complexe d'échange cationique reflète la capacité du sol à retenir les ions. Le
critère "teneur en argile + 5*teneur en matière organique" est proportionnel à la CEC : il est
utilisé pour calculer les teneurs souhaitables.
En classe de première S, on peut également étudier la mobilisation
biologique des substances minérales et relier les connaissances fondamentales
sur la nutrition du végétal aux applications technologiques récentes.
Nous avons pu disposer d'ordinateurs et de clés électroniques en nombre
suffisant pour faire travailler les élèves en petits groupes de deux ou trois par
machine. Le recours au logiciel se fait sous la forme de petites séquences qui
suscitent et accompagnent l'acquisition de connaissances et s'insèrent parmi
d'autres investigations menées au laboratoire et sur le terrain.
a. Activités sur le terrain et en T.P.
L'étude de l'agroécosystème commence de manière classique par un travail
sur le terrain. Les élèves visitent une parcelle de maïs par exemple, précisent
l'état de la culture (montaison, floraison, fructification, maturation), notent
l'état de déshydratation de la culture, recherchent d'éventuels parasites, font
l'inventaire des adventices (variétés, localisation, densité). Puis ils évaluent la
densité des pieds sur la parcelle, recherchent des pieds de référence qui sont
rapportés au lycée où il servent à l'évaluation de la biomasse.
L'étude de terrain est complétée par un travail au laboratoire au cours
duquel on évalue la biomasse d'un hectare de maïs et on détermine la
productivité de l'agrosystème. Cette évaluation permet de faire prendre
conscience des quantités énormes de matière exportée par la culture au moment
de la récolte et de s'interroger sur l'origine de cette matière. Avec le logiciel, il
est alors possible d'aborder le problème de la quantification de ces exportations
et de rechercher leurs facteurs de variation.
b. Utilisation du logiciel
Les options du logiciel nécessaires à cette étude ont été retenues avec des
simplifications : dans l'option paramétrages, par exemple, nous avons retenu
six cultures différentes correspondant à deux types de rotations : une rotation
de type "polyculture-élevage" et une rotation de type "grande culture". Nous
avons aussi choisi trois parcelles aux propriétés physico-chimiques différentes.
Chaque parcelle est divisée en deux sous-parcelles ; ainsi un même sol peut
recevoir les deux types de rotation.
Dans l'option prévision on s'est intéressé principalement aux conseils de
fumure en P 0 , K 0 et secondairement aux conseils en CaO, MgO, alors que
les fonctions qui utilisent les caractéristiques physico-chimiques et établissent
les formules d'engrais en optimisant les coûts ont été retenues au Lycée
Agricole de Fondettes.
2
5
2
3. Les étapes du travail
a. Les exportations minérales
Le travail avec le logiciel va permettre, d'abord, d'avoir une évaluation
chiffrée des exportations minérales de quelques cultures. Chaque groupe
d'élèves choisit ses cultures, ses rendements et le type de récolte (résidus
enfouis ou non), et reporte les informations dans un tableau (fig. 2).
CULTURES
Blé
Maïs
grain
Maïs Tournesol
fourrage
Betteraves
Colza
RENDEMENTS
60q
45q
12t
35q
600t
35q
54
30
12
60
31
23
9
45
-
45
28
14
7
60
50
54
60
53
35
14
28
45
77
19
45
66
180
48
144
63
317
14
7
108
480
126
150
88
245
49
28
Prairie
8t
RESIDUS ENFOUIS
P205
K20
MgO
CaO
kg/ha
kg/ha
kg/ha
kg/ha
_
RESIDUS N O N ENFOUIS
P205
K20
MgO
CaO
kg/ha
kg/ha
kg/ha
kg/ha
72
108
21
108
28
112
8
20
Fig. 2.- Exportations minérales en fonction des objectifs de rendement et du
mode de récolte pour sept espèces (ou variétés) végétales.
Le logiciel donne accès à un grand nombre de paramètres inaccessibles
autrement. La richesse de la banque de données qui l'accompagne (une
quarantaine de cultures), la possibilité de retenir des rendements variables dans
des limites compatibles avec des situations réalistes, le choix du devenir des
résidus, permettent une diversification de la recherche et une appréhension fine
du réel.
Cette phase aboutit à une mise en commun des résultats. Une représentation
graphique synthétique des quantités exportées par la récolte et des quantités
restituées par les résidus est élaborée (fig. 3).
E x p o r t â t i ons<
grains)
90
Kzm
Rast i t u t i ons(pai 1 1«)
30
130
50
20
Cal
15
80
( U n i ta*s : k g / h a )
Fig. 3.- Exportations
60q.
minérales d'une culture de blé pour un rendement
de
b. Les caractéristiques du sol
Cette approche quantitative des exportations agricoles conduit les élèves à
formuler de nouveaux problèmes : comment le sol peut-il couvrir les besoins
des cultures en mettant à la disposition de la plante de l'eau et des ions ? Quels
sont les facteurs pédologiques qui conditionnent la nutrition des végétaux ?
En travaux pratiques, on réalise l'analyse physico-chimique d'un échantillon
de terre (correspondant à une parcelle réellement visitée) en tenant compte des
paramètres retenus par le logiciel. On entreprend également une analyse
granulométrique "grossière" suivie de la recherche de quelques éléments
minéraux. Cette analyse reste incomplète et imparfaite car les méthodes mises
en oeuvre sont très éloignées de celles pratiquées par le technicien, mais cette
approche concrète facilite notablement la compréhension des résultats.
L'analyse physico-chimique de l'échantillon, réalisée préalablement par un
laboratoire spécialisé, est stockée dans la base de données. L'appel de cette
analyse permet de définir les notions de structure, de texture et de complexe
argilo-humique qui sont nécessaires à l'évaluation du degré de fertilité de la
terre.
Les principaux éléments minéraux (P2O5, K 0 MgO, CaO et N a 0 ) sont
quantifiés .
2
2
2
L'analyse du sol étant réalisée, comment l'interpréter ? Le logiciel fournit
cette interprétation : le degré de fertilité est exprimé en comparant les
différentes teneurs analysées (teneurs réelles) à des teneurs souhaitées (teneurs
optimisées) (fig. 4).
2
P
2
O
5 exprime la teneur en Phosphore : en réalité celui-ci existe sous forme d'ions
phosphorique H2PO4", HPO4", PO4""". Il en est de même pour le potassium qui est
présent sous forme de K , le magnésium sous forme de Mg++ et le calcium sous forme
de Ca++.
+
Noh
de la parcelle
Date de prëlëvenent
Lieu de prêlêvenent
Noh
du laboratoire
MICHOUETTE
INRA
Analyse « r a s a i « M é t r i q u e e n
graviers >2mm
8
1006
terre fine
sables grossiers 292
sables f i n s
114
1 irions grossiers 231
268
1 irions f i n s
argile
95
pour
ni l i e
Dligoêlênents :
bore
8.00
cuivre
0.90
zinc
0.00
M a n g a n è s e 8.00
fer
8.00
Analyse p h y s i c o - c h i n i q u e :
Conseils
natiêres organiques 16.00
noyen
calcaire t o t a l
0.00
ph
7.80 alcalin
carbone
9.34
azote t o t a l
1.08
rapport C/N
8.65
faible
CEC
0.00
Analyse c h i n i q u e :
P205 assinilable
8.07
potasse échangeable K20 Ç-Jl
calciun échangeable CaO 3 sodiun échangeable Na20
M a g n é s i e échangeable MgO 8«87
teneurs souhaitables
16.08
pauvre
pauvre
0.183
0.211
correct
0.081
1 5
0
<
Etat calcique : sol â p h a l c a l i n , p h correct nais réserve calcique
faible, â s u r v e i l l e r .
Conseils en M
g
O : l a t e n e u r du s o l
satisfaisante
en
wagnêsiuH assinilable
est
Conseils en P205 : Un redressenent de 399 u n i t é s de P205 est souhaitable à r é p a r t i r sur plusieurs années pour é v i t e r
l e s p e r t e s o u les b l o c a g e s d ' a u t r e s é l ë n e n t s
u t i l e s â l a plante. Nous vous conseillons :
90U pdt 3 a n s p u i s 45U p d t 3 a n s .
Conseils en K2I : La teneur du sol en potassiun assinilable est
insuffisante. Un r e d r e s s e M e n t de 429 unités de
K20 p a r a i t nécessaire, i l vous p e r M e t t r a une
M e i l l e u r e r é g u l a r i t é d e s r e n d e M e n t s . Nous v o u s
conseillons: 180U p d t 3 ans puis 50U p d t 3 ans.
Fig. 4.- Interprétation d'une analyse de terre. Le logiciel Isafumure
des normes d'exportations définies par la station de l'iNRA de Laon. Il
pour chaque analyse des teneurs souhaitées et des conseils de fumure.
exploite
propose
Quelle est la signification de ces valeurs théoriques, et quel est le mode de
raisonnement à travers lequel le spécialiste évalue le degré de fertilité d'une
terre ? Les élèves comparent les résultats obtenus pour trois sols : un sol
argilo-limoneux, un sol argileux et un sol limono-sableux. Ces sols sont décrits
par leurs teneurs en argile et en matières organiques. Il semble qu'il existe une
relation entre ces teneurs et celles qui sont souhaitables en P2O5, K 2 O , MgO et
CaO. Cette hypothèse peut être testée grâce au logiciel en modifiant pour une
même parcelle, soit le taux d'argile, soit le taux de matière organique ; on
découvre ainsi que le modèle d'évaluation du degré de fertilité d'un sol s'appuie
sur les propriétés du complexe argilo-humique.
Tenears
souhaitables
exprimes
en
en
P285, K2I
et
Hj
X.
•.4
K20
• . 3
P285
e.2
-
HflO
8.1
8.8
e
8
288
Tene u r s
488
€88
sauna t a k l e s
e x p r i nées; e n
en
en
X.
t88
P205
K2I
et
NflO
X.
8.4
1(28
/
8.3
P28S
8.2
8.1
8.8
Tenears
8
28
48
C8
•8
l
M
en
araaniqae
en
ratière
expr i nées
X.
Fig. 5.- Les teneurs souhaitables en P2O5, K 0, MgO et CaO varient en
fonction des teneurs en argile (5a) et des teneurs en matières organiques (5b).
2
c. Amélioration de la fertilité des sol
Sachant que tous les sols n'ont pas le même degré de fertilité, on peut
proposer aux élèves de définir une stratégie visant à améliorer celle de
quelques parcelles dans le respect de l'environnement. Si l'agriculteur souhaite
maintenir le degré de fertilité de ses parcelles et leur niveau de production, une
fertilisation de redressement s'impose suivant que les sols sont pauvres ou
riches en éléments nutritifs. Pour une situation précise (un type de sol, un type
de culture), les élèves élaborent des propositions de fertilisation. En
interrogeant le logiciel qui fournit les conseils de fumure, ils sont amenés à
juger de la pertinence de ces propositions et à réfléchir sur les modalités
d'application (fractionnement des apports, étalement dans le temps). On sait que
ces modalités sont responsables de conséquences écologiques considérables.
Pour mieux correspondre à la réalité de la décision agricole, l'exploitation
du logiciel devrait prendre en compte la dimension économique, ce qui est
possible mais n'a pas été entrepris dans le cadre de ce travail.
B. Rationalisation de l'irrigation : le logiciel LORA
1. Fonctionnalités
Ce logiciel s'adresse aux agriculteurs irrigants, aux techniciens et conseillers
concernés par la gestion de l'eau. Il permet de choisir des cultures, de leur
attribuer une surface sur l'exploitation agricole et d'adopter un mode de
conduite (culture irriguée ou culture à sec) (fig. 6).
ETP
et
S T A T I O N MET E U DE
ANNEE 1 9 9 0
p l u i e s e n mm
BI.OIS
Fig. 6.- LORA exploite des données météorologiques réelles. La base de
données comporte les valeurs de l'ETP et de la pluviométrie sur 15 ans dans 45
secteurs géographiques. Les informations concernant la station météorologique
de Blois montrent l'importance du déficit hydrique durant l'été.
La prise de décision s'appuie sur des contraintes liées à l'exploitation et aux
ressources naturelles disponibles. Elle prend également en compte les
conditions climatiques à propos desquelles subsistent de nombreuses inconnues.
Comment prévoir les besoins en eau d'une culture en début de campagne ?
Comment calculer les besoins sachant qu'ils varient en volume dans le temps
selon le climat, le sol et les cultures ?
Pour évaluer les besoins en eau des cultures et prévoir les conséquences d'un
stress hydrique sur la production, le logiciel exploite des modèles biotechniques
sol-climat-plantes fondés sur des références contenues dans des bases de
données régionalisées. Il utilise un ensemble de scénarios climatiques qui
peuvent être constitués à partir des relevés météorologiques des années passées.
Il prévoit les conséquences de ces scénarios en prenant en compte le contexte
pédologique (fig. 7) et en exploitant des modèles biotechniques élaborés par les
chercheurs de l'INRA.
TYPES DE SOLS PROFONDEURS
Boulbènes
Boulbènes
Boulbènes
Terrefort
Terrefort
Limon de vallée
Limon de vallée
Ségala
Ségala
Alluvion de vallée
Alluvion de vallée!
30
60
90
60
90
110
80
40
80
60
20
RU unit
QD total
RU total
1,8
1,8
1,8
2
2
2,2
2,2
1,8
1,8
2
2
32,4
64,8
89,1
72
99
122,1
99
43,2
81
72
117
48,6
97,2
145,8
108
162
217,8
158,4
64,8
129,6
108
216
etc.
F i g . 7 . - Les données pédologiques peuvent être enrichies par des données
locales lorsqu'elles existent. RU : Réserves utiles. QD : quantités disponibles.
Le logiciel comporte des données biologiques concernant de nombreuses
cultures d'hiver (blé, colza,...) et d'été (maïs, sorgho, tournesol, soja,...) pour
lesquelles les risques liés aux incertitudes climatiques sont importants. Ainsi, ce
logiciel fait le lien entre la mobilisation biologique et le flux d'eau des végétaux
d'une part, et la production primaire dont il propose l'amélioration d'autre
part.
2. Utilisation pédagogique
Elle s'est déroulée collectivement sur un seul poste de travail (une seule clé
de protection disponible).
L'exploitation du logiciel permet d'obtenir une quantification des
phénomènes hydriques au niveau de l'agrosystème : quelle est la demande en
eau liée au climat dans les Landes au mois de juillet, par exemple ? Quels sont
les besoins hydriques d'une culture de maïs en juillet dans cette région ?
Quelles seront les conséquences au niveau de la production si les besoins en eau
sont ou ne sont pas satisfaits ? Quelle culture choisir et quelle surface lui
attribuer sur l'exploitation si les ressources en eau sont insuffisantes ?
Préalablement à l'utilisation du logiciel, les élèves connaissent le rôle
fondamental de l'eau pour une culture (de maïs en particulier). Ils savent que
pour maintenir ou accroître les niveaux de production les agriculteurs ont
recours à des cultures en mode irrigué qui peuvent avoir des conséquences sur
l'environnement puisque les niveaux des nappes phréatiques baissent. C'est un
problème d'actualité et les questions ne manquent pas : l'agriculteur peut-il
maintenir ou accroître ses niveaux de production tout en exploitant
raisonnablement les gisements d'eau ? Comment parvenir à une maîtrise de
l'eau dans le respect de l'environnement ?
La classe se trouve dans la situation du professionnel qui doit, en début de
campagne, choisir un assolement, prévoir les modes de conduite (en irrigué ou
à sec) compte tenu des nombreuses inconnues qui peuvent intervenir (le climat,
les prix, etc.). Le logiciel est interrogé par l'enseignant ou par les élèves. Il
joue le rôle d'un expert auprès duquel la classe obtient des réponses précises
aux questions qu'elle se pose. L'exploitation des données météorologiques,
pédologiques et biologiques issues du logiciel ainsi que l'élaboration des calculs
des bilans hydriques sont effectués par les groupes en utilisant des outils
complémentaires (grapheur et tableur).
a. Les besoins en eau des plantes
Quels sont quantitativement les besoins en eau des cultures ? En consultant
les informations fournies par le logiciel, on peut établir que les besoins en eau
dépendent :
- des types de cultures : les besoins en eau des cultures d'été sont plus
importants que ceux des cultures de printemps ou des cultures d'hiver. Les
besoins en eau d'une culture de Maïs sont élevés : ils varient entre 472mm et
170mm soit 4720 m3/ha et 1700 m3/ha. Par contre les besoins en eau d'une
culture de blé sont faibles : les besoins varient entre 190mm et 0mm soit
1900m3/ha (fig. 8).
496.7_
PARCELLE H I C M U E T T E
-t-^t—i—i—i—t—J . I
,
ib
1
<7»> <78> (80) <S2> (I4> (83> <S&> (87) <88> <89)
Scénario» cliwtiqu—
200.Q_
(76) (78) (80) (82) (84) (85) (86) (87) (88) (89)
Fig. 8.- Les informations concernent des cultures installées sur un limon
sableux profond : les demandes en eau d'irrigation sont établies à partir des
données climatiques de 10 années.
- de la texture du sol : les besoins en eau sont plus faibles sur un sol de type
argileux ou argilo-limoneux que sur un sol limono-sableux. En travaux
pratiques, l'élève va réaliser l'étude des propriétés physico-chimiques de
quelques sols : texture, capacité de rétention de l'eau, réserve facilement
utilisable par la plante (RFU).
- du climat : en comparant les besoins des cultures en eau et les données
météo contenues dans la banque de données on constate que les deux éléments
pris en compte dans le bilan hydrique sont l'ETP et les pluies (fig. 9). Le bilan
hydrique est excédentaire en hiver mais il devient largement déficitaire en été.
Alors que les cultures d'hiver achèvent leur cycle de développement et ne
semblent plus dépendre des apports d'eau, la demande en eau des cultures d'été
est forte.
DONNEES METEOROLOGIQUES DE L'ANNEE 1976 FOURNIES
PAR LE NODULE GESTHETEO BU LOGICIEL LORA.
STATION DE BLOIS.
MOIS
JANVIER
FEVRIER
•
MARS
PLUIES en m
AVRIL
MAI
JUIN
JUILLET
AOUT
SEPTEMBRE
OCTOBRE
NOVEMBRE
DECEMBRE
B
Fig. 9.- Données
3
10
15
20
25
30
35
40
45
météorologiques.
b. Les réserves en eau du sol
Ces réserves peuvent-elles assurer les besoins des cultures en été ? Si les
réserves pédologiques sont insuffisantes, quelles en sont les conséquences sur la
production primaire ?
La conduite de deux cultures, Maïs et Sorgho à différents régimes
d'irrigation (100%, 80% et 60% de l'ETP) ou à sec montre que l'irrigation joue
un rôle important sur l'augmentation
et la régularité des niveaux de
production. Cependant, les risques liés aux incertitudes climatiques peuvent être
compensés en partie par l'irrigation ou bien en choisissant des cultures adaptées
aux risques climatiques.
Fig. 10.- La production de maïs est très dépendante des échanges d'eau entre
l'hydrosphère et l'atmosphère. A sec, le déficit peut atteindre 35 quintaux par
hectare. Placée dans les mêmes conditions climatiques et pédologiques,
une
culture de Sorgho est moins sensible au déficit hydrique.
c. L'adéquation besoins-ressources
Quels sont les modèles qui permettent à l'irrigant de gérer l'eau au niveau de
l'agroécosystème ?
Lorsque la capacité d'irrigation est limitée, on ne peut agir ni sur le sol ni
sur le climat. En revanche, une mise en adéquation doit être envisagée entre les
ressources et la demande en eau d'irrigation. Les élèves doivent donc définir un
assolement et décider quelles cultures ils envisagent d'irriguer et quelles autres
ne le seront pas.
^
Le problème est complexe : le logiciel propose deux solutions d'assolement
qui prennent en compte les contraintes agro-climatiques et économiques de la
situation concrète étudiée.
Des graphiques permettent une analyse rapide des résultats. Pour chaque
solution, ceux-ci concernent : la répartition des surfaces attribuées aux cultures
sur chaque sol (fig. 11), les conduites d'irrigation et la part non irriguée pour
chaque culture (fig. 12), le volume d'eau utilisé et les décades où la capacité
d'irrigation s'est avérée limitante (fig. 13).
MODELE
ARGILO
LORA
:
REPARTITION
CALCAIRE
LIMONO
DES
CULTURES
ARGIL.PROF.
PAR
T!IPE
LINON
DE
SOL.
SABL.PROF.
Fig. 11.- La répartition des surfaces attribuées aux cultures sur chaque sol et
sur l'ensemble des périmètres irrigables.
Fig. 12.- Recherche du meilleur assolement
scénarios climatiques passés.
BESOINS
-volune
-décades
E N EAU
d'eau
où
la
D'IRRIGATION
A
en fonction
des
différents
L'ETH.
utilisé
capacité
s'est
avérée
liMi tante.
PJPJ
SORCHO
[FT1
TOURNESOL
DECADES
LIMITANTES
SEPT.
Fig. 13.- Le volume d'eau utilisé et les décades où la capacité s'est avérée
limitante.
Ces quelques exemples donnent un aperçu de la richesse du logiciel qui
fournit une approche globale du problème de l'eau au niveau d'un écosystème.
Basée sur des données locales, cette approche constitue une situation
pédagogique nouvelle particulièrement motivante pour des élèves de lycée.
C. Nutrition animale : le logiciel
DIETAL
1. Fonctionnalités
Ce logiciel fournit une aide dans l'établissement d'un plan de rationnement
des Vaches laitières. Parmi les différentes options qu'il propose, nous avons
retenu celle qui concerne l'élaboration d'un rationnement équilibré pour les
vaches en pleine lactation. L'élaboration d'un tel rationnement passe par quatre
étapes : détermination de la ration de base (pâture ou fourrage), des apports en
concentrés correcteurs destinés à équilibrer la ration de base, des apports en
minéraux, des apports en concentrés de production destinés à ajuster
l'alimentation à une production laitière donnée.
L'aide à la décision est fournie par l'intermédiaire d'une simulation établie
sur les fichiers d'aliments et les modèles élaborés par l'INRA (1988). A chaque
étape sont visualisés sous forme de diagrammes, les effets de l'adjonction de tel
ou tel aliment sur la production laitière. Lorsqu'une ration alimentaire est
équilibrée pour un niveau de production donné, on peut voir comment évoluent
les quantités de chacun des composants (fourrage, concentrés, etc.) pour
différents niveau de production et apprécier le caractère réaliste ou irréaliste
des objectifs ainsi fixés.
2. La nutrition en vue de la production de lait
La production laitière est une production secondaire qui correspond à une
transformation de matière végétale en matière animale. Au cours de cette
transformation, la vache puise dans son alimentation des nutriments et de
l'énergie ; elle produit du lait riche en glucides, lipides, protides, eau et divers
ions. L'aliment utilisé, d'origine végétale, présente des caractéristiques
chimiques très différentes de celles du lait. Pour expliquer ce fait, il est
indispensable de connaître la physiologie digestive des digastriques et les
mécanismes associés (digestion, fermentation, absorption) ainsi que le
fonctionnement de la glande mammaire (assimilation).
En première S, ces notions sont acquises en cours d'année de manière
dispersée et selon des optiques différentes : ainsi la digestion est surtout
envisagée sous l'angle de la catalyse enzymatique et de la simplification
moléculaire, l'assimilation sous l'angle du renouvellement biologique et de la
mise en réserve, les fermentations sous l'angle énergétique.
L'utilisation du logiciel D I E T A L ne peut accompagner l'acquisition de ces
connaissances, mais il permet de les réinvestir dans un nouveau contexte.
Le programme normal des classes de première permet aisément d'introduire
les connaissances préalables nécessaires. Ainsi, lors de l'étude des aliments des
animaux, une analyse de la composition du lait est réalisée avec électrophorèse
du lactosérum, et les notions de taux butyreux et de taux protéique (critères de
qualité du lait) sont introduites. La relation entre régime herbivore et structure
particulière de l'appareil digestif est esquissée. En revanche, les mécanismes
physiologiques de la production laitière doivent être insérés spécialement en
vue de cette utilisation.
Bien qu'il s'agisse d'une application spécialisée, les concepts scientifiques
impliqués ne sont pas hors de portée des élèves. Ils sont même intéressants dans
la manière dont ils sont abordés : ainsi la valeur nutritionnelle de la ration est
évaluée en quantité de lait permise (donc en termes de production secondaire).
Cette dernière est elle-même déterminée en fonction de l'apport énergétique de
la ration de l'animal (énergie investie dans la fabrication de lait) et en fonction
des possibilités de protéosynthèse bactérienne qu'elle permet (aliments et
énergie utilisables par les bactéries).
L'inconvénient réside dans l'expression de ces paramètres qui utilise des
normes correspondant à des pratiques (UFL, PDIN, PDIE etc.). De ce fait,
l'exploitation du logiciel nécessite quelques connaissances sur les pratiques
courantes dans un élevage. Dans l'élevage "hors-sol" par exemple, l'aliment de
base est du foin ou de l'ensilage dont la composition est plus favorable à un
équilibre alimentaire. Ces prérequis technologiques peuvent être ramenés à des
connaissances minimales et aisément exprimés en termes biologiques.
3. La physiologie des ruminants
La glande mammaire prélève dans le sang des substances nécessaires à la
synthèse du lait : ces substances sont issues de l'alimentation. Cependant, des
substances présentes dans l'alimentation de l'animal (herbe) sont absentes du
lait (polyosides, matières azotées non protidiques) ; des substances présentes
dans le lait à forte dose n'existent qu'à faible dose dans l'alimentation (oses,
protéines, lipides, ions) (fig. 14).
L'alimentation est riche en polyosides (cellulose), mais l'appareil digestif de
la vache ne comporte pas les enzymes nécessaires à l'hydrolyse de la cellulose.
Les apports alimentaires ne semblent donc pas de nature à couvrir directement
les besoins liés à la production laitière. Dans ces conditions, d'où viennent les
acides aminés à l'origine du lait ? D'où viennent les oses ? Les acides gras ?
ANALYSE COMPAREE 0 ' UNE HERBE DE PATURAGE
ET DU L A I T
OSES
DE VACHE
POLYOSIDES
PROTEINES
(cellulose)
(RA9-GRASS
(teneurs
NS
N.AZOTEES
non
D'ITALIE)
Z.)
LIPIDES
prot.
IONS
3
_
Ca,P04
HERBE DE
PATURAGE
LAIT
VACHE
150
401
38
9
1
376
0
256
e
296
9
DE
Fig. 14.- Analyse comparée d'une herbe de pâturage
du lait de Vache.
72
(Ray-grass d'Italie) et
L'étude de l'organisation de l'appareil digestif de la vache, par les moyens
classiques, révèle la présence des micro-organismes (Bactéries) qui colonisent
la panse et le réseau. Les bactéries dégradent des protéines alimentaires et des
matières azotées non protéiques (source de nutriments) ainsi que de la cellulose
(source d'énergie) : il en résulte, d'une part, une intense protéosynthèse donc
une multiplication bactérienne importante, d'autre part une production d'acides
gras. Ainsi la panse apparait comme un fermenteur (fig. 15).
Fig. 15.- L'activité bactérienne a pour résultat une intense multiplication
une production d'acides gras.
et
Ce sont, entre autres, les produits issus de ce fermenteur qui sont absorbés et
utilisés par la glande mammaire pour la production lactée : des acides aminés
provenant de l'hydrolyse des protéines bactériennes au niveau de la caillette et
de l'intestin, des acides gras stockés sous forme de glycogène dans le foie puis
libérés dans le sang sous forme d'osés.
Le devenir des ions dépend des quantités disponibles : si l'apport alimentaire
est trop pauvre en Ca ou P, l'animal puisera dans les réserves de son squelette
qui se fragilisera ; dans le cas contraire, les besoins seront couverts par les
apports, tout excès de Ca ou P permettant même un stockage dans le squelette.
L'énergie nécessaire à cette synthèse lactée provient de la ration alimentaire.
Cette mise en place réunit les connaissances acquises à différents moments
(composition des aliments, digestion, assimilation, stockage, production
d'énergie, fermentation, etc.) et les intègre dans la compréhension d'un
mécanisme global. On aboutit ainsi à la construction d'un modèle (fig. 16) qui
fait le lien avec la nomenclature utilisée dans le logiciel.
[FERMENTATION |
(proteosyntnèse)
Protéines —
Alimentaires
(hydrolyse)
4
ACIDES AMIBES
feuillet
caillette
intestin
I-+ACIDES GRAS
Mat. Azotées —^1
non protéïques
II
PDIN
*
Protéines
NE?
PDIE
Oses,
ENERGIEK " Microbiennes
Cellulose
CIDES GRAS «
—rIONS
jABSORPTIOU
sang
UTILISATION
DES
NUTRIMENTS
Ions:P04Hi,Cû<
panse
Squelette
Ions Glucose Ac. gros Ac. Aminés
IUFL I
r
glvcerol
I
P04HÎ
34 Hî Lactose Lipides Protide
.Ca
LAIT
Fig. 16.- Physiologie digestive de la vache laitière.
Glande
mammaire
Les nutriments (acides aminés et acides gras) nécessaires à la fabrication du
lait proviennent de la multiplication bactérienne qui dépend :
- de l'énergie issue de la cellulose disponible : PDIE exprime la quantité de
protéines susceptibles d'être produites par la protéosynthèse bactérienne
compte-tenu de l'énergie disponible.
- des matières azotées disponibles : PDIN exprime la quantité de protéines
susceptibles d'être produites par la protéosynthèse bactérienne à partir des
matières azotées alimentaires.
La production lactée nécessite de l'énergie ayant pour origine le glucose et
les acides gras sanguins : UFL exprime l'énergie à la disposition de l'animal
pour la production lactée (1 UFL = 7230 KJ ).
L'objectif du travail est d'arriver à l'optimisation de la production laitière
c'est-à-dire l'obtention d'une production maximale au moindre coût et le
maintient de l'équilibre physiologique de la vache. Les élèves doivent avoir une
idée précise de la situation dans laquelle il vont se placer : la visite d'une
exploitation de production laitière ou le visionnement d'un document vidéo
donnent un aperçu des principes de l'élevage, de la nature et de la destination
des installations, des différents types d'aliments utilisés (foin, ensilage,
déshydratés, etc.)
4. Le rationnement en stabulation libre
Dans une situation d'élevage en stabulation libre, comment obtenir la
production laitière la meilleure possible ? Les élèves, en utilisant le logiciel,
doivent atteindre plusieurs objectifs qui correspondent aux étapes de
l'établissement du plan de rationnement formulées en termes biologiques.
a. La valeur nutritive des aliments
Tous les fourrages ont-ils la même valeur alimentaire ? Il s'agit de comparer
la valeur nutritive de quelques fourrages à travers les productions laitières
permises.
Les résultats sont notés dans un tableau. On peut ainsi déterminer pour les
aliments testés, le ou les facteurs qui limitent la production. On constate qu'un
aliment naturel ne permet pas d'équilibrer la ration alimentaire (fig. 17).
RATION
DE
BASE
Ensi lage de riaïs
CONCENTRES
C X MB
U 99
MS
BRUTE
Lait
1
11.3 42.15
UFL
PDIN
PDIE
PDIA
P
Ca
9
4
7
5
5
1
3
5
7
9
i
UFL PDN PDE QTE
INTERPRETATION
UFL:production de l a i t
pernise par l'énergie
de la ration soit 9 1 .
PDIN:
NINERAUX
QTE /g
41 et
PDIE:
71.
déséquilibre entre les
Matières azotées et
Ténergie disponible
pour la protéosynthèse.
< facteurs 1iMitants)
Fig. 17.- Première étape du rationnement d'une vache laitière. L'aliment est
fourni à volonté "v", c'est de l'ensilage de maïs.
Si la part énergétique de la ration (UFL) permet d'espérer une production de
9 litres de lait, la multiplication bactérienne dans le fermenteur limite cette
production à 4 ou 7 litres (les matières azotées ou PDIN et l'énergie disponible
PDIE jouent le rôle de facteurs limitants). Le déficit en éléments minéraux n'est
pas préoccupant, l'animal pouvant puiser dans les réserves minérales de son
squelette.
On aboutit ainsi à un aliment de base (ou à une association d'aliments de
base) présentant le meilleur équilibre nutritionnel. Le plus souvent, le facteur
limitant est constitué par le déséquilibre entre les protéines et les matières
azotées disponibles pour les bactéries (PDIN) et l'énergie dont elles disposent
(PDIE). Il faut avant tout optimiser la protéosynthèse en équilibrant les apports à
destination des micro-organismes.
b. Equilibrer les apports alimentaires
L'aliment de base ayant été choisi, il faut apporter un complément à
l'alimentation sous forme de concentré correcteur : le choix s'opère de manière
raisonnée à partir de fiches de composition des aliments mis à la disposition des
élèves.
n°
355
616
677
64
505
1
5
21
20
641
714
Cat
E
C
T
V
F
D
X
A
M
S
N
NOM
MS
ensdac l e ep 19.6
orge
86.9
tourt soja
87.8
dactyle épi 16.7
foin dac épi 88.0
mél soja orge 86.3
ts orge craie 85
coopdor lacto 87
ucaphos
100
drêches brass 22
urée
98
UFL PDIN PDIE
0.81 72
1.00 69
1.04 341
0.83 90
0.72 83
0.98 133
0.98 132
1.00 160
0
0
0.92 223
0 1443
60
89
231
86
84
127
120
150
0
189
0
PDIA
P
18
26
182
32
35
69
63
110
0
156
0
3
4
7
3
3
3
4
6
140
6
0
Ca
3
1
3
3
3
15
11
12
140
3
0
etc..
CATEGORIES
V: vert et pâture
F: foin
E: ensilage
R: racine
P: paille
C: céréales
D: déshydratés
T: tourteau
X: mélange ferme
A: alim commerce
M: minéraux
S: sous-produit
N: azote non
NATURE
mat.vég. fraîche (pré)
mat.vég. séchée
mat.vég. fermentée
mat.vég. fraîche
mat.vég. séchée
mat.vég. séchée
mat.vég. déshydratée
reste de végét traités
utilisation
fourrage
fourrage
fourrage
fourrage
fourrage
fourrage
concentré
concentré
aliments industriels
concentré
minéraux
concentré
concentré
urée
Fig. 18.- Extrait d'une fiche de composition
Unité
kgMS
kgMS
kgMS
kgMS
kg MS
kg MB
kg MB
kg MB
kg MB
kg MB
kg MB
kg MS
kg MB
d'aliment
PDIA : désigne la quantité de protéines d'origine alimentaire
bactérienne) utilisable pour la production lactée.
(et non
MS : Masse sèche, MB : Masse brute.
Le logiciel calcule la quantité de concentré nécessaire à l'équilibre PDIN/PDIE
et UFL. Les résultats (sous forme d'histogramme) sont pris en note (fig. 19). Le
plus souvent un déséquilibre subsiste au niveau minéral.
RATION DE BASE
MB
'A
E n s i l a g e de n a ï s
MS
99
CONCENTRES
T o u r t e a u de s o j a
BRUTE
Lait
9
42.15
UFL
PDIN
PDIE
PDIA
P
Ca
15
16
15
11
H
3
15
PDE QTE
INTERPRETATION
*B4 341
:
E q u i l i b r e de l a r a t i o n p a r
I ' a p p o r t de T o u r t e a u
F o r t d é f i c i t en Minéraux
HINERAUX
l'anirtal prélève sur son
squelette
QTE / g
EQUILIBRE
: 15,3
litres
Fig. 19.- Deuxième étape de l'équilibration de la ration alimentaire de la
vache laitière : choix de concentrés correcteurs (le critère retenu est un
équilibre entre PDIN et PDIE).
c. Eviter le prélèvement sur le squelette
L'apport d'un concentré minéral est optimisé par l'ordinateur à partir des
minéraux disponibles dans un fichier. A ce stade, l'équilibre alimentaire est
obtenu pour une production de lait relativement faible. Il faut donc accroître
cette production.
d. Accroître la production lactée
Pour cela, il faut augmenter les apports alimentaires sans rompre l'équilibre
établi. On utilise un "concentré de production" dont le choix s'opère aussi de
manière raisonnée à partir de la fiche de composition des aliments (fig. 20).
RATION DE BASE
E n s i l a g e de n a ï s
A
MB
99
MS
BRUTE
Lait
29
11.31 4 2 . 1 5
UFL
PDIN
PDIE
PDIA
P
Ca
30
37
35
25
49
48
31
33
35
37
CONCENTRES
T o u r t e a u de s o j a
341 1231 1.52
INTERPRETATION
Coopdor
160 150 6 . 1 8
- E a u i l i b r e de l a r a t i o n p a r
l ' a p p o r t de Minéraux.
lactopic
:
- A j u s t e H e n t à un n i v e a u de
production par l ' a p p o r t d'
concentré.
HINERAUX
QTE / g
Ucaphos 14 14 3
51
EQUILIBRE
Fig. 20.- Choix d'un concentré de production.
35
litres
Bilan : Une synthèse des résultats peut-être effectuée sous la forme d'un
histogramme cumulatif des productions de lait permises par les différents
composants de la ration. Cette construction est établie a la main ou à l'aide d'un
grapheur (fig. 21).
RATKUtCNEMT D'UNE VACHE LAITIERE :
PRODUCTION DE LAIT PEKHISE .
LAIT PERHIS (titras)
Fig. 21.- On visualise ici le déséquilibre des apports liés à la ration de base,
l'intérêt du concentré de correction, la nécessité du concentré minéral. Le
concentré de production élève la production lactée et permet une mise en
réserve de substances minérales.
5. La nutition au pâturage
L'alimentation de l'animal au pâturage permet-elle une production laitière du
même ordre qu'en stabulation ? Nécessite-t-elle des compléments alimentaires ?
Le travail est une application du problème précédent. On impose la nature de
la pâture (Dactyle) et son stade de végétation (1er cycle épiaison). On constate
que si la pâture permet un équilibre, un complément énergétique et minéral
doit être apporté pour obtenir une production laitière convenable.
RATION DE B
A
S
E
Dactyle é p i a i s o n
C
u
'A
MB
99
lis
BRUTE
Lait
15,1 98,49
UFL
PDIN
PDIE
PDIA
P
Ca
11
13
15
19
18
10
4
e
Fig. 22.- La production laitière d'un animal au pâturage.
15
17
19
a. L'évolution de la prairie dans le temps
La période de consommation d'un fourrage en pâture est-elle indifférente ?
A travers le fichier d'aliments, les élèves sont confrontés à des faits : la prairie
évolue dans le temps (cycle de végétation). Y-a-t-il une période plus favorable
à l'alimentation de l'animal ? Y-a-t-il des inconvénients ou des risques à
certaines périodes ? (fig. 23).
épiaison
JUIN
Fig. 23.- Les deux cycles d'une Graminée pluriannuelle : le premier cycle
comporte la montée des tiges et leur fructification. Le second cycle et les
suivants sont purement feuillus.
Il suffit de collecter les informations uniquement pour la ration de base et de
réaliser une comparaison, par exemple à l'aide d'une représentation graphique.
On constate que la période de consommation du fourrage en pâture n'est pas
indifférente :
- En début de cycle (Dactyle feuillu), l'apport énergétique du fourrage est
important (UFL=30) en rapport avec l'énergie fournie par l'aliment ; celui-ci
étant peu encombrant, l'animal en ingère davantage, mais il y a un risque
d'accumulation de N H 3 (qui ne peut-être réutilisé par la protéosynthèse) avec
transformation en urée par le foie (d'où fatigue et intoxication).
- En milieu de cycle (Dactyle épiaison), l'apport énergétique est plus faible
(UFL=15), mais l'équilibre P D I N - P D I E est convenable. On peut penser qu'il
s'agit de la période favorable.
- En fin de cycle (floraison), l'apport énergétique est faible (UFL =5) et il y
a un déséquilibre P D I N - P D I E . La période est moins favorable. La fauche est
conseillée.
La période de consommation du fourrage fait donc intervenir l'énergie
apportée, sa composition (PDIN-PDIE), son encombrement (quantité ingérée par
l'animal) (fig. 24).
CyCLE OU DACT9LE ET UoLEURS NUTRITIONNELLES
IC Fe
|U
UFL
I C Ep
H
IC Fl
MS I n g .
2C Re
fJ|Pl)IN *
3C Re
100 | |
.
4C Re
PDIE *
190
Fig. 24.- Cycle du Dactyle et valeurs nutritionnelles pour la Vache laitière.
b. La valeur alimentaire des fourrages
- Tous les fourrages ont-ils la même valeur alimentaire ? La comparaison
Fétuque - Dactyle (1er cycle) montre que la Fétuque ne permet pas une
production laitière aussi importante que le Dactyle ; par contre sur le plan de la
production primaire, elle a une productivité record.
- Le mode de récolte et de conservation du fourrage intervient-il sur sa
valeur alimentaire ?
4
On compare un ensilage de Dactyle (fin épiaison = période de fauche) au
Dactyle au même stade en pâture : l'aliment ensilé correspond à une production
permise plus faible, malgré une teneur en UFL plus élevée (l'encombrement
étant plus important, l'animal en ingère moins).
On compare un Foin de Dactyle (1er cycle épiaison = période de fauche) à
un ensilage de Dactyle = le foin permet une production laitière plus importante
(malgré une teneur en UFL plus faible) : l'animal en ingère davantage.
La comparaison de Foin de Dactyle (1er cycle épiaison) à une pâture de
Dactyle épiaison montre que la quantité de lait permise est légèrement
inférieure avec l'utilisation du Foin.
En conclusion, on établit que l'animal en pâture a une alimentation
favorable à la production laitière, mais cette période favorable est limitée
le temps. L'utilisation d'un fourrage conservé (ensilage, foin) permet
alimentation constante dans ses caractéristiques mais impliquant
complémentation.
III.
plus
dans
une
une
SYNTHESE
Dans le cadre d'un enseignement général, mettre l'élève en situation de
recherche et d'expérimentation sur le thème de la production secondaire est
difficile : on peut présenter des applications technologiques (visites d'élevages,
de laboratoires de recherche, visualisation de documents) mais l'élève reste
spectateur. Le logiciel professionnel traite des données réelles et simule des
phénomènes basés sur des mécanismes biologiques déterminés. Les
interprétations quantitatives et qualitatives référées à des normes (sencées être
fondées et fiables) assurent une bonne crédibilité du travail. La situation est
aussi plus motivante : grâce aux fichiers intégrés au logiciel, il est aisé de
dépasser l'approximation des résultats des travaux pratiques et de poursuivre
un travail plus approfondi sur des données plus précises.
4
Lors de la "mise en conserve" de l'herbe, il y a une perte élevée de la valeur fourragère.
Outre les pertes liées à la méthode de collecte, on doit considérer les pertes par respiration
(la plante fauchée continue à vivre tant que sa teneur en eau est supérieure à 35%) et les
pertes dues à la pluie (des constituants solubles très digestes sont lessivés).
L'ensilage est la conservation d'un fourrage par l'acide lactique élaboré par voie
microbienne (fermentation en mode anaérobie) à partir des sucres qu'il contient.
Dans la conservation des fourrages par voie sèche (les foins), le principe est de ramener la
teneur en eau de l'herbe à 15% et au dessous afin qu'elle se conserve sans fermentation.
La dessiccation peut-être obtenue par exposition au soleil, à l'air ou par ventilation.
Nous avons montré sur trois exemples le parti pédagogique que l'on peut
tirer de tels logiciels. Il convient de noter cependant, que leur exploitation dans
l'enseignement n'est pas immédiate, pour plusieurs raisons.
D'abord, il s'agit de logiciels spécialisés qui manipulent de ce fait des savoirs
scientifiques ou techniques qui ne sont pas de pratique courante. Il faut donc
accéder d'abord à une bonne maîtrise des modèles et des techniques sous-jacents
à leur conception. La collaboration de nos collègues de l'enseignement agricole
a été déterminante sur ce plan.
Il convient en second lieu de procéder à une sélection des fonctions qui
cadrent le mieux avec les objectifs et les méthodes d'enseignement. Ce sont en
premier lieu les fonctionnalités qui expriment et traitent des problèmes
biologiques qui nous intéressent, ce qui ne constitue parfois qu'une petite partie
du logiciel. Lorsque le logiciel est de bonne facture technique, ceci peut ne pas
être gênant dans la mesure où on peut travailler de manière indépendante sur
l'un ou l'autre module du logiciel Les logiciels anciens sont dans l'ensemble
assez lourds, alors qu'un logiciel comme LORA, à menus déroulants, peut être
aisément pris en main. Dans tous les cas, il a été indispensable de préparer à
l'usage des élèves des notices-guides pour faciliter le repérage des fonctions et
des traitements utiles
Le troisième élément qui nous a freiné dans l'exploitation de tels outils est
leur accessibilité économique. Dans le domaine agricole, les logiciels d'aide à la
décision sont assez chers, compte tenu de la capacité d'achat d'un établissement
d'enseignement général (Le prix d'achat de versions multiples d'un logiciel
professionnel agricole est tout simplement prohibitif : près de 1700 F .
l'exemplaire pour le logiciel D I E T A L ) . C'est pour cette raison d'ailleurs que
dans l'enseignement agricole, les établissements scolaires sont affiliés à un
réseau géré par le C N E R T A , et bénéficient, à des conditions avantageuses,.des
produits mis à la disposition de cet organisme par les professionnels.
En ce qui nous concerne, la Société ISAGRI a accepté de nous prêter huit
exemplaires du logiciel I S A F U M U R E pour effectuer le travail d'analyse relaté
ici. Nous n'avons pas pu bénéficier de prêts similaires auprès des autres
concepteurs.
Comme tout produit informatique, les progiciels agricoles ont une durée de
vie très courte s'ils ne bénéficient pas de mises à jour. De plus, compte-tenu de
la complexité des modèles qu'ils intègrent et de l'évolution des connaissances
scientifiques, certains sont retirés du marché. A la date d'achèvement de ce
rapport (novembre 1992), les progiciels I S A F U M U R E , D I E T A L et L O R A sont
toujours proposés par les distributeurs.
BIBLIOGRAPHIE
- J.M. ATTONATY : La gestion et les nouveaux moyens informatiques. (INRA Annales de
Gembloux 1985).
- J.M A T T O N A T Y - P DELPECH : Un programme de formules d'aliments (Revue
Aliscope.Elevage et alimentation animale Editions Corel mars - avril 1987).
- N. SALAME, A. BARRERE, J.BARRERE, JY.DUPONT, B.MOULIA. : Using décision
making software in natural science teaching, 7th International conférence on Technology and
Education, Bruxelles, 1990.
- Progiciels agricoles pour micro-ordinateurs, Association de Coordination Technique Agricole,
Paris, 1989, 1992.
- SOLTNER : Les bases de la production végétale (T 1 : le sol). Collection Sciences et
techniques agricoles, 1988.
- SOLTNER : Les grandes productions végétales. Collection Sciences et techniques agricoles,
1988.
- SOLTNER : L'alimentation des animaux domestiques. Collection Sciences et techniques
agricoles, 1988.
- R. JARRIGE : Alimentation des bovins, ovins, caprins, INRA ,1988.
- CRZV Theix : Alimentation des ruminants. Révision des systèmes et des tables. INRA.
Bulletin Technique n° 70,1987.
ANNEXE 1
Logiciels d'aide à la décision
pour la production animale et pour la production végétale
MENUALI
- Objectifs : Enregistrement direct de la composition de rations dans le but d'un
suivi. Vérification et optimisation de la composition d'une alimentation pour
bovins et détermination du coût. Tenue d'un stock d'aliments.
- Description : Trois cents aliments sont répertoriés répartis en 15 catégories
(fourrages, pailles, ensilages, concentrés, etc.). Les besoins nutritifs sont définis
pour 10 catégories d'animaux et sont exprimés en fonction du gain de poids vif
recherché (en g/j) pour les animaux à l'engraissement ou en fonction de la
période de lactation pour les vaches allaitantes. L'optimisation de la ration est
effectuée à partir de 2 fourrages et de 2 concentrés.
- Date de création : 1980.
- Concepteur :
Contrôle laitier de la CAIAC (Côte d'Or)
Frocl Bourgogne 3 rue Jules Rimet
89400 MIGENNES
ALIPORC
- Objectif : Vérification de la composition d'une alimentation de porcs en
élevage et détermination du coût. Elaboration d'une alimentation équilibrée et
optimisation.
- Description : Une quarantaine d'aliments sont répertoriés ; le logiciel définit
les caractéristiques de la matière première (teneur en masse sèche, cellulose
brute, énergie digestible, matières azotées totales et acides aminés secondaires).
Les besoins nutritionnels sont définis pour 10 catégories d'animaux. Comptetenu de la catégorie d'animaux à nourrir et des matières premières à intégrer à
l'alimentation, le logiciel calcule la composition du complément azoté minéral
et vitaminique et d'une céréale pouvant compléter le mélange.
- Date de création : 1984.
- Concepteur :
Institut technique du porc (ITP)
La Motte au Vicomte BP 3
35650 LE RHEU
Institut des techniques céréalières et fourragères (ITCF).
PORFAL
- Objectif : Calculer au moindre coût des formules ou des rations alimentaires
en recherchant la combinaison de matières premières (ou aliments) la plus
économique pour couvrir les besoins nutritionnels d'une catégorie d'animaux.
- Description : Les matières premières (betteraves, luzerne, tourteau de soja,
phosphate bicalcique,...) sont définies par leur nom, leur prix et leur
composition en nutriments. On appelle nutriment toute caractéristique d'un
aliment (composition chimique, son taux de masse sèche, l'énergie potentielle
qu'il renferme). Les besoins alimentaires qualitatifs et quantitatifs sont définis
par le nutritionniste.
- Date de création :1983. Mise à jour : 1990.
- Concepteur :
Institut technique du porc (INRA).
DIETAL
Matériel : Compatibles PC. Disque dur de 20 Mo. Mémoire centrale 640 Ko.
Date de création : 1988. Mise à jour : 1991.
Concepteur :
FROCL BOURGOGNE.
Distribiteur :
UCAGIC
F O R M U L E BLE
- Objectif : recherche d'une variété de blé adaptée aux conditions
agroclimatiques, recherche de traitement (propose un désherbant adapté, un
fongicide, ...), calcule une dose d'engrais azotée.
- Date de création : 1989.
- Concepteur :
Institut des Technique Céréales et des Fourrages (ITCF).
La Jaillère La Chapelle Saint Sauveur
44370 VARADES
LORA
- Matériel : Compatibles PC. Disque dur de 20 Mo. Mémoire centrale 640 Ko.
- Date de création :
1990.
- Concepteur - Distributeur : Lora a été conçu par l'INRA et par l'ITCF.
ISAFUMURE
- Matériel : Compatibles PC. Disque dur de 20 Mo. Mémoire centrale 640 Ko.
- Date de création : 1985. Mise à jour : 1991.
- Concepteur - Distributeur : SAGRI / Service commercial.
Rue Pierre Waguet BP 313
60026 BEAUVAIS.
SUIVI MULTIPARAMETRE
DE MILIEUX BIOLOGIQUES COMPLEXES
EXEMPLE : LA FERMENTATION
G. Chambon, G. Orsini, P. Faure, J.F. Schmit
L'équipe est particulièrement
redevable à :
- M. MARC, Ecole Nationale Supérieure de l'Industrie Chimique, Nancy
Le Lycée Antoine de Saint Exupéry de Fameck est Jumelé avec l'entreprise PIERRON, à
Sarreguemines, qui a apporté son soutien technique à ce projet.
SUIVI M U L T I P A R A M E T R E
DE MILIEUX BIOLOGIQUES COMPLEXES
EXEMPLE : LA FERMENTATION
231
G. Chambon, G. Orsini, P. Faure, J.F. Schmit
I. LES ASPECTS PEDAGOGIQUES
A. Les savoirs
1. En biologie
2. En chimie
3. En physique
B. Les savoir-faire
II. LE SUIVI TECHNIQUE D'UNE FERMENTATION
A. Dans l'industrie
1. Les fermenteurs
2. Les capteurs
3. Les échantillonneurs
4. les dosages
B. Dans l'enseignement
1. Les matériels disponibles
III. MISE AU POINT DES EXPERIENCES
A. Contrôle des conditions de pH et de température
1. Essai 1 à température ambiante
2. Essai 2 à une température plus élevée
B. Régulation du pH et de la température
C. Dosages du glucose
D. Dosages de l'alcool
IV - MISE EN OEUVRE D A N S LES CLASSES
A. Séquence d'initiation
1. Objectifs
2. Principe du T.P.
3. Résultats
B. Séquence de transfert
1. Principe du T.P.
2. Protocole expérimental
3. Consignes
231
232
232
233
233
234
234
234
234
234
235
235
235
235
236
237
238
239
241
241
242
243
243
243
243
244
244
244
244
245
V. CONCLUSIONS ET PERSPECTIVES
246
ANNEXE
248
SUIVI MULTIPARAMETRE
DE MILIEUX BIOLOGIQUES COMPLEXES
EXEMPLE : LA FERMENTATION
Une des principales caractéristiques du monde vivant est la multiplicité des
paramètres pour chaque phénomène biologique. Les techniques classiques
d'expérimentation dans le secondaire ne permettent d'en suivre que quelques
uns avec un nombre de mesures réduit. L'expérimentation assistée par
ordinateur ( E . X A . O ) , qui réalise le couplage d'une interface en liaison avec les
paramètres d'un milieu et d'un micro-ordinateur, constitue un outil de choix
pour repousser les limites de l'expérimentation.
Pour des élèves et pour de nombreux adultes, la représentation des sciences
dans l'enseignement secondaire, est caractérisée par un cloisonnement
disciplinaire. La réalité industrielle montre une collaboration indispensable et
étroite entre diverses disciplines. Nous avons décidé de travailler sur le suivi
d'une fermentation pour une production de boisson (la bière, par exemple) en
relation avec un laboratoire de biotechnologie à l'Ecole Nationale Supérieure
de l'Industrie Chimique de Nancy.
I. L E S A S P E C T S
PEDAGOGIQUES
Les objectifs que nous nous sommes fixés sont les suivants :
- établir de manière interdisciplinaire la liste des savoirs et des savoir-faire
que ces suivis peuvent apporter pour les élèves tant en physique-chimie qu'en
biologie-géologie,
- étudier le transfert de suivis de milieux biologiques réalisés en recherche
ou dans l'industrie et rendre le transfert possible dans les travaux pratiques,
avec les moyens techniques, matériels et humains des lycées.
A. Les savoirs
1. En biologie
Les fermentations sont actuellement aux programmes dans le cadre des
problèmes énergétiques et biotechnologiques.
- L'énergétique :
Une fermentation est une dégradation incomplète de glucose limitée à la
glycolyse qui permet la formation d'ATP et de molécules organiques résiduelles
contenant encore de l'énergie chimique potentielle. Les différents types de
fermentations sont classées en fonction de la molécule résiduelle : fermentation
alcoolique, butyrique, lactique, etc. C'est un aspect complémentaire de la
notion de respiration et de métabolisme, au niveau cellulaire.
- Les biotechnologies et le génie biologique :
La plupart des fermentations sont réalisées grâce à des micro-organismes.
Celles-ci sont utilisées pour des productions industrielles très anciennes comme
le secteur des boissons alcoolisées et celui des fromages et yaourts. Le
développement de l'étude des micro-organismes et du génie génétique a permis
d'autres applications : valorisation de déchets et de sous-produits agricoles ou
industriels, production de biomasse, production industrielle de molécules utiles
à l'homme (vitamines, antibiotiques,...), étude des problèmes d'environnement
(pollution par les pétroles,...). Les notions purement biologiques liées aux
micro-organismes sont également très intéressantes : classification, description,
fonctions de relation, de nutrition, de reproduction, etc.
- Les autres applications :
Actuellement, seule l'étude du fonctionnement musculaire fait mention de la
fermentation lactique, et encore seulement dans son aspect de production
d'énergie utilisable. Un certain nombre de notions souvent très théoriques
peuvent tout de même être abordées par les fermentations :
- Les problèmes de régulation constituent le premier exemple : on
peut faire comprendre "en direct" aux élèves les notions de voie sensitive et
voie motrice, récepteur et effecteur, centre de régulation, système de contrôle
et de rétrocontrôle.
- L'illustration de la complexité d'un milieu. On peut montrer
l'influence des modifications d'un paramètre sur un ensemble de facteurs d'un
milieu biologique. C'est ainsi que l'on peut aborder les notions de seuil, de
facteur limitant, de carence, de toxicité, de facilitation, de synergie, etc.
- Le troisième exemple concerne les modes de vie d'un ensemble
très important d'organismes mal connus des élèves, les micro-organismes, et
des développements sur la notion de cellule.
2. En chimie
Les fermentations sont inscrites au programme dans le cadre des problèmes
suivants :
- Les réactions chimiques : une des caractéristiques fondamentales d'une
réaction chimique concerne sa cinétique qui est difficilement visualisable en
T.P. Le suivi informatisé d'une fermentation, qui est une réaction sur plusieurs
heures peut combler cette lacune.
Les réactions biologiques utilisent systématiquement des enzymes. La notion
de catalyse enzymatique est un point très important dans notre étude. Elle
permet d'aborder les problèmes de fonctionnement des catalyseurs en fonction
des différents paramètres de la réaction. Le contrôle d'une réaction et la
régulation, par exemple, du pH et de la température permettent une approche
nouvelle de ces notions.
- Le suivi d'une réaction : ce suivi peut être effectué soit en direct avec
des capteurs, soit en différé grâce à des prélèvements. A chaque fois cela
suppose le choix des paramètres à suivre et des méthodes de dosage et de
mesure à utiliser. On peut ainsi aborder les notions de dosage, d'oxydation du
substrat et les problèmes liés à l'identification des espèces biochimiques.
3. En physique
Les notions liées aux fermentations appartiennent au domaine énergétique :
bilan énergétique d'une réaction, réaction endo et exothermique, réactions
d'oxydo-réduction. D'autre part, les techniques utilisées vont permettre
d'illustrer l'usage des spectres d'émission et d'absorption de solutions colorées.
B. Les savoir-faire
L'étude des fermentations permet l'apprentissage dans des conditions
relativement faciles d'un nombre important de techniques concernant :
- La méthodologie expérimentale
- suivre un protocole expérimental,
- suivre des consignes, par exemple faire des mesures,
- travailler avec soin et précision.
- Les techniques d'observation
- utiliser le microscope (observation des micro-organismes),
- utiliser la loupe binoculaire,
- faire de la numération de cellules.
- Les techniques de base du laboratoire :
- utiliser de la verrerie et des instruments (pipette jaugée,
propipette,...),
- élaborer et réaliser un milieu de culture,
- effectuer des dosages,
- manipuler en conditions stériles.
- Les technologies nouvelles au service du laboratoire
- utiliser les techniques d'E.XA.O. : capteurs, mesures, etc.
- contrôler un milieu réactionnel.
II. LE SUIVI TECHNIQUE DUNE FERMENTATION
A. Dans l'industrie
Les laboratoires qui travaillent sur les fermentations pour des boissons
alcoolisées ont pour objectif de produire des boissons standards que le public
va apprécier. Ils disposent de techniques adaptées qui vont nous servir de
modèle : l'informatique y est utilisée pour rendre les réactions complexes
optimales de telle façon que le rendement soit le plus important possible dans
le cadre d'une production standardisée et économiquement viable.
1. Les fermenteurs
L'industrie utilise deux types de fermenteurs :
- des fermenteurs en discontinu constitués par une cuve qui est mise en
fermentation le temps nécessaire à la transformation du substrat initial,
- des fermenteurs en continu qui sont alimentés par un substrat dont sort
en continu le produit fermenté.
Le problème le plus important est de travailler en milieu stérile afin de
pouvoir effectuer des fermentations sur un temps assez long. Cela est plus
facile dans le premier cas, en stérilisant tout au départ ,et demande plus de
soins dans le second cas.
2. Les capteurs
Le contrôle des procédés de fermentation se limite à la mesure d'un nombre
limité de paramètres avec des capteurs classiques : pH-mètre, thermomètre,
capteur de pression, débitmètre, spectrophotomètre. Ils permettent un suivi
particulièrement précis des réactions dans le temps.
3. Les échantillonneurs
Les capteurs en direct ne permettent pas de connaître la composition des gaz
de fermentation ou du milieu réactionnel. Des techniques de prélèvement ont
été mises au point afin d'effectuer ce suivi à l'aide de la spectro-photométrie.
Le problème du prélèvement en cours de réaction dans un milieu stérile a ainsi
été résolu.
4. les dosages
Les dosages à partir d'échantillons prélevés dans le milieu de réaction vont
permettre de doser certaines molécules organiques grâce à des réactions
d'oxydo-réduction. Ces techniques remplacées par la spectro-photométrie
devraient pouvoir trouver leur place au lycée, dans les années à venir.
Il faut noter l'importance du pilotage informatisé qui va permettre grâce à
des mesures en continu d'assurer une alimentation et un fonctionnement
optimal d'un fermenteur continu dont les rendements sont évidemment bien
supérieurs à un fermenteur en discontinu.
B. Dans renseignement
Il est bien sûr impensable pour un lycée d'utiliser des matériels industriels de
par leur prix de revient. Cela n'est d'ailleurs pas nécessaire : nous n'avons pas
besoin d'une précision importante.
1. Les matériels disponibles
a. Les équipements informatiques et périphériques
Nous disposons pour cette étude des différentes interfaces réalisées pour
l'E.X.A.O. :
avec sa gamme de capteurs,
avec le réacteur biocell et un spectrophotomètre,
- BOTENS (Jagot et Léon) avec oxymètre,
- ORPHYS (MECACEL) avec oxymètre,
- SMF10 (PIERRON)
- E S A 0 3 (JEULIN)
- BIO1000 (NORTEK).
b. Les fermenteurs
Nous avons acquis un fermenteur en verre de 1 litre avec lequel les premiers
essais ont été réalisés. Par la suite, il s'est avéré que l'on pouvait travailler sans
difficultés avec des récipients conventionnels nettement moins onéreux. Le
problème de la stérilité indispensable dans l'industrie augmente le coût des
matériels. Au lycée, les temps de fermentation seront réduits pour éviter ce
problème.
c. Les capteurs et effecteurs
Parmi les capteurs existants, nous nous sommes limités à l'utilisation des
sondes thermiques et d'une sonde pH. Pour les effecteurs, nous avons opté
pour une résistance chauffante d'aquarium et une pompe péristaltique (voire
une microburette automatique).
d. Le milieu de fermentation
Pour une fermentation d'une durée de moins de 8 heures, qui ne nécessite
pas de conditions stériles, nous avons utilisé le milieu de composition suivante :
-
glucose 10 g/1,
extrait de levure (source de vitamines) 0,5 g/1,
sulfate d'ammonium (source d'azote) 5 g/1,
phosphate monopotassique 2 g/1,
sulfate de magnésium 1 g/1,
chlorure de sodium 0,5 g/1,
chlorure de calcium 0,1 g/1,
eau distillée pour compléter à 1 litre.
On ajoute 2 grammes de levure de boulangerie (en poids sec) pour un litre
de milieu. Il faudra compter dans ces conditions une période de latence de
quelques heures. La température optimale de fermentation est vers 30°C, le pH
sera compris entre 4,5 et 5 unités pH.
e. Les montages expérimentaux
Dans un premier temps, on utilise le milieu réactionnel dans lequel plongent
les capteurs : on se limite à enregistrer les données. Dans un second temps, on
régule pH et température, ce qui implique des effecteurs et l'intégration de
valeurs seuils.
III. MISE AU POINT DES EXPERIENCES
Les courbes ci-après montrent deux exemples de fermentations réalisées sans
contrôle avec un simple suivi. Leur but est de se rendre compte de l'ampleur
des problèmes de suivi. Ce type d'expérience devrait d'ailleurs suffire pour
atteindre nos objectifs pédagogiques. Lors d'une fermentation de glucose en
présence de levure de bière (Saccharomyces cerevisiae), on obtient une solution
qui contient un grand nombre de types moléculaires dont les caractéristiques
(exemple : la teinte) ne permettent pas un suivi simple avec un seul réactif et
une seule réaction de coloration.
Le bilan global de la fermentation alcoolique est le suivant :
C6H1206—~>2 C2H50H + 2 C 0 2 + énergie
On peut donc envisager de suivre cette réaction par la mesure du volume de
dioxyde de carbone dégagé, par la production d'éthanol, ou par la variation de
la teneur en glucose du substrat initial. Pour le volume de dioxyde de carbone,
on peut soit le mesurer, soit suivre le pH de la solution qui est un reflet du
dégagement de dioxyde de carbone (par l'acide carbonique).
Pour permettre une fermentation optimale nous serons amenés à réguler le
pH et donc nous ne pourrons alors que suivre la quantité d'alcool produite et la
consommation de glucose. Ces mesures ne peuvent se faire que par des
prélèvements dans le milieu de fermentation.
A. Contrôle des conditions de pH et de température
voie afférente"
6
Jf
6
•••••••••••
•••••••••••
•••••••••••
LEGENDE
l
Bain-marie + fermenteur
*
Sonde pH
—i
Sonde thermique
V
Agitateur
0 0
Interface
1
Clavier-ordinateur
Fig. 1.- Premier dispositif expérimental utilisé lors des essais
préalables.
1. Essai 1 à température ambiante
On constate qu'en 4 heures (temps limité par le logiciel initial), le pH du
milieu varie de 6 à 4,7 unités pH, soit une variation de 1,3 unités pH, c'est à
dire une augmentation de 15 fois de l'acidité. Dans le même temps, La
température a augmenté de 2°C, sans doute comme la température extérieure,
facteur que nous n'avions pas pris en compte. La température a été un peu
faible pour optimiser la réaction. La variation de pH nous montre la précision
qui nous sera nécessaire pour réguler le pH. La durée de l'expérience semble
insuffisante pour terminer la fermentation.
jClroisir une touche: H,F,S,C,D.L.T,I/El
Fig. 2.- Simple suivi du pH et de la température avec la première version du
logiciel.
2. Essai 2 à une température plus élevée
Nous avons tenté de travailler à une température supérieure, voisine de
30°C, en utilisant un agitateur magnétique chauffant. Sur la figure 3, la courbe
supérieure sur le document des températures indique la température du milieu
de fermentation, la courbe du bas celle de la pièce. On confirme le fait que la
variation de température du premier essai était due à la variation de
température de la pièce au cours de l'expérience. Il faut noter la forme de la
courbe du haut qui illustre le mécanisme de régulation de l'agitateur
magnétique. Le pH est passé de 7,8 à 6,3 unités pH soit une variation de 1,5
unités en 5 heures. La stabilisation au bout de 3 heures est à relier à la fin de
l'utilisation du substrat, les réactions ayant été accélérées par la chaleur par
rapport au premier essai.
Fig. 3.- Fermentation conduite à une température voisine de 30°.
Modifié, le logiciel permet d'enregistrer et de restituer simultanément les
paramètres température et pH sur une période très importante (plusieurs jours)
et de réguler ces mêmes paramètres après introduction de valeurs seuils. A
partir de ces valeurs, l'interface active par un système de relais
électromagnétiques, soit une résistance chauffante placée dans un bain-marie,
soit une pompe péristaltique distribuant une solution de soude 0,1M ; une
valeur supérieure inactive les effecteurs.
»
"voie afférente'
L
E
G
E
N
D
E
Î,
Bain-marie + fermenteur
*
Sonde pH
—i
Sonde thermique
V
Agitateur
0
Interface
0
±
<
Clavier-ordinateur
Résistance
^
Pompe à galets
»
Soude 0,1 M
Fig. 4.- Dispositif
température.
• • • • • • • • • • •
• • • • • • • • • • •
• • • • • • • • • • •
1
1
expérimental
utilisé pour la régulation
du pli et de la
B . R é g u l a t i o n d u p H et de l a t e m p é r a t u r e
Le nouveau logiciel est testé sur une période de huit heures, limite à partir
de laquelle les problèmes de conditions stériles commencent. D'abord, les
possibilités de régulation ne sont pas activées. Les résultats obtenus sont
conformes à ceux obtenus lors de l'essai 1 : la courbe correspondant à la
variation de pH présente la même pente.
On teste ensuite la régulation du pH sur une durée de huit heures. La valeur
seuil est fixée à pH=7. La fermentation est lancée sur une période de huit
heures : la valeur du pH ne variant pas tout au long de l'expérience, le système
de régulation est efficace, cependant seule une analyse des substrats et produits
permettra d'en déduire l'action.
On teste simultanément la régulation du pH et de la température sur une
fermentation pendant huit heures (fig. 5). Les valeurs enregistrées sont
sublinéaires, ce qui démontre l'efficacité du système de régulation, avec les
mêmes réserves pour l'action sur le substrat.
~T
1
1
1
1
1
1
1
r-
50 100 150 200 250 300 350 400 450
~1
1
1
i
1
1
1
.
100 150 200 250 300 350 400 450
Fig. 5.- Régulation du pH et de la température sur une période de 8 heures
C.
Dosages d u
glucose
Le dosage du glucose s'effectue par photo-colorimétrie : on utilise des
bandelettes dont la coloration varie en fonction de la concentration en glucose.
La coloration est évaluée par un colorimètre par rapport à un témoin étalon
incorporé à l'appareil électronique : la valeur du taux de glucose est affichée
en mg/1.
D. Dosages de l'alcool
On utilise le principe du dosage en retour : on oxyde l'alcool par un oxydant
fort en excès de quantité connue (dichromate de potassium en milieu acide). La
réaction n'est pas immédiate : une latence de 20 minutes est nécessaire.
2
3
C r 0 " + 14H+ + 6e-
> 2Cr + + 7 H 0
3CH CH OH + H 0
> CH COOH + 4H+ +4e-
2
7
3
2
2
2
3
2
3
2 C r 0 - + 16 H+ + 3 CH CH OH- —> 3 CH3COOH + 4Cr ++ 11H 0
2
7
3
2
2
On peut constater que deux moles de dichromate de potassium seront
réduites s'il y a 3 moles d'alcool oxydé en acide acétique (éthanoïque). Or un
degré alcoolique correspond à 1 c m d'alcool pur pour 100 c m de liquide.
3
3
3
La masse volumique de l'éthanol est de 0,79 g/cm , donc 1 c m 3 contient
0,79 g d'alcool, soit 7,9 g/1.
Une mole d'alcool a une masse de 46 g donc un degré d'alcool correspond à
0,17 mole/1 d'alcool, c'est à dire que cela nécessite 0,113 mole de dichromate
de potassium pour l'oxyder.
Cependant, dans le milieu réactionnel, le glucose peut aussi s'oxyder : il faut
donc le séparer par distillation.
On dose l'excès de dichromate de potassium par une solution de sel de
Mohr :
(FeS0 ,(NH ) S0 ,6H 0.
4
4
2
4
2
2
Fe +
2
Cr 0? -+14H+ + 6e2
2
2
C r 0 ? - + 6 Fe + + 14 H+
2
3
> Fe + + e3
> 2 Cr + + 7 H 0
2
3
- — > 2 Cr + + 6 F e
3 +
+ 7H 0
2
La concentration en sel de Mohr étant 6 fois plus grande que celle du
dichromate, lors du dosage du restant, le volume du sel de Mohr est égal au
volume du dichromate restant, ce qui simplifie les calculs. De même, la
concentration du dichromate (0,115 mol/1) est telle que 1 c m de dichromate
oxyde 1 c m d'alcool.
3
3
Les dosages effectués traduisent une augmentation de la production d'alcool.
Cependant le nombre limité d'expérimentations réalisées à l'heure actuelle
nous oblige à une réserve sur les valeurs obtenues, tant les variations sont
importantes. Comment cela peut-il s'expliquer.
IV - MISE EN O E U V R E DANS LES CLASSES
Le choix et le niveau de la séquence sont parfaitement ciblés : le thème des
fermentations en classe de première S, avec une approche biologique et
chimique. Cependant, afin que le travail pluridisciplinaire soit intégré le plus
tôt possible dans les habitudes scolaires, une séquence d'initiation précédant la
séquence principale est recherchée et débouché sur le choix de l'effet de serre,
en classe de seconde.
Pour mettre au point ces deux séquences un langage commun s'avère
nécessaire. La recherche du vocabulaire commun utilisé en biologie-géologie
et en physique-chimie sur les trois niveaux du second cycle est réalisée par les
élèves (cf. annexe 1).
A. Séquence d'initiation
1. Objectifs
• Méthodes : le principal objectif est une initiation à l'utilisation d'une
chaîne d'E.X.A.O. en physique-chimie et en biologie-géologie. La sonde
thermique constitue un capteur simple utilisé dans les deux disciplines, qui ne
nécessite aucun réglage ni étalonnage et qui donne des mesures absolues
précises. Pour bien montrer à l'élève l'intérêt du poste informatisé, nous allons
brancher deux sondes identiques, voire une sonde lumière.
• Connaissances : dans le cadre du chapitre sur l'amélioration de la
production primaire, on peut introduire les notions d'effet de serre. Il s'agit de
faire prendre conscience aux élèves de la diversité et du nombre des
paramètres agissant sur les cultures sous serre. On va également aborder des
questions relatives à l'environnement.
2. Principe du T.P.
Le principe est de suivre, en direct, l'évolution de la température à
l'intérieur et à l'extérieur d'une serre miniature. Nous allons placer un capteur
thermique dans la serre et un autre à l'extérieur. Chaque capteur est relié à
l'interface qui va transformer les informations obtenues en valeurs utilisables
par l'ordinateur. Ce dernier va traiter ces données et construire les courbes en
fonction du temps. Une fois l'effet de serre mis en évidence, on pourra étudier
un certain nombre de paramètres, en fonction du temps disponible et du
matériel possible : influence du type de radiations, de la matière du couvercle
de la serre, de la couleur du couvercle de la serre, de la surface sur laquelle
repose la serre, etc. Un suivi de l'intensité lumineuse peut permettre de mieux
quantifier l'influence de certains de ces paramètres.
3. Résultats
La température dans la serre augmente plus qu'à l'extérieur : les
rayonnements infrarouges sont piégés dans la serre, et plus une lampe aura un
spectre riche en rayons infrarouges plus l'effet sera visible. La différence peut
atteindre plus de 5°C en 10 minutes.
L'étude des différentes couleurs du couvercle montre que certaines
augmentent l'effet de serre. Il en est de même avec la couleur du sol de la
serre. L'éloignement de la source lumineuse a pour effet de diminuer l'effet de
serre. Une isolation thermique va limiter les pertes de chaleur de la serre et
augmenter l'effet. L'application de cette expérience est évident pour
l'amélioration de la production primaire.
Remarque : attention à l'influence de la lumière du jour lorsqu'il y a
beaucoup de soleil.
B. Séquence de transfert
1. Principe du T.P.
Le principe est de placer des levures dans un fermenteur, en conditions non
stériles, et de suivre en fonction du temps les variations de paramètres
biologiques et chimiques. Deux types de situations expérimentales sont prévus :
• en l'absence de régulation de la température et du pH,
• en présence d'une régulation de la température et du pH.
Les résultats obtenus dans la première situation caractérisent la fermentation
sur un plan qualitatif, le second dispositif représente la mise en place d'une
biotechnologie et doit permettre d'apprécier son apport sur le plan quantitatif.
Les élèves sont répartis en binômes auxquels on affecte une situation
expérimentale régulée ou non. Au cours de la séquence, chaque élève effectue
en alternance une quantification des paramètres biologiques (observation
microscopique et dosage du substrat) et des paramètres chimiques (distillation
du prélèvement et dosage de l'alcool).
2. Protocole expérimental
Le but de cette manipulation est de suivre le développement des agents de la
fermentation (levures), de quantifier les variations du substrat (glucose), de
quantifier les transformations réalisées (alcool). Ces observations se feront sur
une période de 8 heures, en absence de tout contrôle et en présence d'un
système régulateur.
Une séquence de T.P. étant de trois heures pour les deux groupes, il est
judicieux d'échelonner le départ des fermentations de sorte qu'à la fin de la
séquence on puisse avoir des résultats correspondant à chacune des huit heures
et ce pour les 2 types de situations (cette méthode est plus facile à mettre en
place si la séquence doit se dérouler sur un après-midi). Les résultats de tous
les groupes sont reportés sur un tableau.
La composition du milieu est celle précédemment indiquée.
Pour chaque poste :
- E X A O SMF10, logiciel ferment, sonde pH, sonde thermique.
- 500 ml de substrat dans un bêcher et 1 g de levure (poids sec) à
mélanger en respectant les indications de temps,
- un bêcher de 100 ml, une pipette de 50 ml, un compte goutte, eau
iodée,
- un agitateur magnétique,
- un microscope, lame à comptage, 4 bandelettes tests.
Pour le (s) poste (s) régulé (s) : agitateur, bain-marie, thermostat, pompe
péristaltique, soude 0,1M, branchements effectués au SMF10.
3. Consignes
A chaque poste est affecté un binôme : une série de mesures biologiques est
effectuée par l'un pendant que l'autre se charge des mesures chimiques ; après
40 minutes, on alterne de sorte que chaque élève réalise les deux types de
mesures. Les résultats sont portés au tableau.
- Mesures biologiques
- noter les valeurs de la température, du pH, du temps écoulé depuis le
mélange substrat-levure,
- prélever une goutte de milieu, la déposer sur une lame à comptage et la
mélanger à une goutte d'eau iodée,
- observer au microscope et évaluer la densité de population des levures,
- plonger une bandelette dans le milieu en fermentation, attendre 1
minute,
- placer la bandelette dans le photo-colorimètre et noter la valeur
indiquée (en g/1),
- faire le schéma du dispositif expérimental.
- Mesures chimiques (en salle de T.P. de chimie)
- Dosages décrits précédemment.
- Bilan
- Inscrire dans un tableau les valeurs obtenues.
- Comparer les résultats.
- En dégager les apports des biotechnologies.
V. C O N C L U S I O N S E T P E R S P E C T I V E S
Nous n'avons pu tester l'exploitation pédagogique que sur une seule année,
aussi les conclusions doivent-elles être manipulées avec prudence.
1. Sur le plan des savoirs et des savoir-faire, les indicateurs de réussite
permettent d'évaluer une couverture des objectifs correspondant à 65 % des
élèves en classe de seconde et à 70 % en classe de première. L'observation des
comportements des élèves en situation a permis de constater que le professeur
doit être très attentif aux protocoles expérimentaux proposés dans le T.P.
d'initiation (tendance des élèves à faire varier simultanément plusieurs
paramètres) et de bien surveiller la réalisation des dosages chimiques
(obtention de valeurs très différentes) dans le T.P. de transfert.
2. Sur un plan pratique, la réalisation de ces séquences pédagogiques
présentait quelques difficultés liées à la concordance des séquences de travaux
pratiques en biologie-géologie et en physique-chimie et à la circulation des
élèves entre les secteurs correspondants. En fait, l'emploi du temps, la
structure de la salle d'Expérimentation Assistée par Ordinateur (8 postes
équipés en interfaces et capteurs identiques), la localisation des secteurs
(biologie au second niveau et physique au troisième niveau du même bâtiment),
et l'habitude des enseignants des deux disciplines à travailler ensemble depuis
quelques années furent des facteurs de réussite non négligeables.
Un tel travail a permis élèves de montrer l'existence de liens étroits entre les
sciences expérimentales enseignées et de découvrir des points de convergence
masqués par la séparation institutionnelle et la tradition des disciplines.
L'utilisation d'expériences assistées par ordinateur permet également de faire
le lien entre l'enseignement théorique et l'enseignement expérimental. Cela
favorise l'introduction de technologies plus modernes présentes dans toutes les
industries depuis de nombreuses années. Cela va également dans le sens d'une
appropriation instrumentale de l'informatique par les élèves.
3. Sur un plan plus technique, la conception et la mise au point du logiciel
qui permet d'évaluer et d'agir sur deux paramètres est suffisamment simple
pour pouvoir être adaptée à d'autres situations.
Parallèlement à cette étude sur les fermentations nous avons adapté ce
système au suivi et à la régulation d'un milieu aquatique. Ce milieu est
représenté par un aquarium ouvert où nous enregistrons en permanence la
température et le pH. Ces valeurs sont saisies par l'ordinateur et comparées a
des valeurs de consigne, et l'action de régulation consiste à agir sur une
résistance chauffante ou sur un ajout de gaz.
Le dispositif est constitué d'une bouteille contenant du dioxyde de carbone
sous pression, reliée à un détendeur muni d'une valve électromagnétique
commandée par l'interface. L'action sur le dioxyde de carbone permet de
réguler le pH et d'avoir une action fertilisante : ce travail est en cours et ses
résultats nous semblent prometteurs.
Une autre piste, nettement moins avancée, concerne le suivi et la régulation
d'une mini-serre, suite cohérente au T.P. d'initiation. Trois paramètres seraient
suivis : la température, le taux de dioxyde de carbone et l'intensité lumineuse.
A partir du logiciel déjà utilisé, l'interface agirait, toujours à partir de
valeurs seuils, sur un ventilateur chauffant ou sur une ouverture du toit pour
réguler la température, sur un système utilisant le dispositif mis au point pour
l'aquarium pour agir sur la concentration en dioxyde de carbone, la mise en
place automatique de rideaux réfléchissants pour agir sur l'intensité lumineuse.
La régulation de la teneur en dioxyde de carbone de la serre peut aussi être
traitée en utilisant un transfert de méthodes industrielles : des contacts sont pris
avec des professionnels du secteur.
Ces projets, plus ou moins avancés, vont pouvoir s'exprimer pleinement dans
le cadre de la rénovation des lycées. Les aspects méthodologiques seront
développés dans les modules. Les aspects expérimentaux trouveront dans les
options un terrain de prédilection
ANNEXE 1
Vocabulaire
Acide
alcane avec radical acide susceptible de céder un proton.
Acide éthanoïque
acide basé sur le squelette carboné de l'éthane.
Aérobie
se dit d'organismes vivants en présence de dioxygène.
Alcool
alcane avec radical alcool.
Aldéhyde
composé organique (groupe fonctionnel -CHO).
Amplitude
différence entre deux maxima.
Anaérobie
se dit d'organismes vivants en l'absence de dioxygène.
Autotrophe
être vivant capable d'élaborer de la matière organique à partir de
matière minérale.
Bilan chimique
comparatif entre les réactifs et les produits d'une réaction.
Bioréacteur
enceinte dans laquelle s'effectue des réactions biochimiques.
Capteur
dispositif permettant de transformer une grandeur physique en un
signal électrique.
Catalyse
réaction facilitée par un catalyseur qui n'intervient pas dans
l'équation.
Champ électrique
champ ou il y a concentration d'électrons.
Combustion
fait de brûler un élément pour savoir s'il contient du carbone ou de
l'eau.
Concentration
terme qui définie la quantité d'un produit dans un autre produit,
Densité
l'eau.
masse volumique d'un objet divisée par la masse volumique de
Dialyse
phénomène passif régissant la circulation des ions à travers une
membrane. Ce phénomène se fait du milieu le plus concentré en
soluté vers le milieu le moins concentré en soluté.
Dioxygène
association de deux atomes d'oxygène par liaison de covalence.
Distillation
procédé thermique consistant à séparer les constituants d'un mélange
homogène.
Dosage
quantification de la proportion des différents corps d'une solution,
Equilibre chimique
équilibre entre les différents éléments chimiques d'une réaction,
Estérifi cation
réaction d'un alcool sur un acide pour donner un esther et de l'eau,
Etalonnage
réglage d'un appareil sur une valeur de référence,
Ethanal
aldéhyde basé sur le squelette carboné de l'éthane.
Ethanol
alcool basé sur le squelette carboné de l'éthane.
Expérimentation
suite d'expériences qui permet d'aboutir à un résultat positif ou
négatif.
Fermentation
transformation de substances organiques sous l'influence d'enzymes
produites par des micro-organismes.
Fermenteur
enceinte permettant de réaliser des fermentations.
Fichier
ensemble de données mises en mémoire.
Fréquence
nombre de périodes contenue dans une seconde.
Gain
rapport d'amplification d'un étage de récepteurs.
Glucide
substance caractérisée par la présence de formule C6H12O6.
Glucose
le sucre à 6 carbone le plus répandu.
Hétérotrophe
être vivant incapable d'élaborer de la matière organique à partir de la
seule matière minérale.
Hydrolyse
destruction d'une molécule par des molécules d'eau.
Interface
appareil permettant de convertir des signaux électriques en signaux
binaires, analysables par un ordinateur.
Iode
élément chimique de base.
Ion
atome qui a perdu ou gagné des électrons.
Levure
champignon microscopique unicellulaire hétérotrophe.
Liaison
covalente
mise en commun des électrons dans une molécule pour avoir la
structure du gaz inerte le plus proche (saturation de la dernière
couche électronique).
Liaison peptidique
liaison qui lie deux acides aminés, avec perte d'une molécule d'eau
par liaison.
Lipide
corps gras renfermant un acide gras.
Logiciel
système d'exploitation et d'affichage de données informatiques.
Marquage
pour déterminer l'origine des différents atomes d'une molécule, on
"colle" un atome radioactif sur une molécule de départ, puis on suit
son cheminement sur une pellicule photographique.
Masse
rapport de la quantité de matière sur la quantité d'espace.
volumique
Milieu
espace gazeux ou liquide aux conditions physico-chimiques précises.
Neutralisation
réaction entre un acide et une base tendant à rendre un milieu.
Organique
résultat de la transformation de la matière minérale par la
photosynthèse.
Osmose
phénomène passif régissant la circulation d'eau à travers une
membrane. Ce phénomène se fait du milieu le moins concentré en
solution (hypotonique) vers le milieu le plus concentré en solution
(hypertonique).
Oxydation
une réaction d'oxydation correspond à une perte d'électrons.
Oxydo-réduction
lors d'une réaction d'oxydo-réduction, le réducteur le plus fort cède
ses électrons et c'est l'oxydant le plus fort qui capte les électrons
cédés par le réducteur fort.
Oxygène
élément chimique de base, également constructeur de la matière
organique.
Oxymètre
instrument permettant la mesure du taux de dioxygène dans un
milieu.
pH
nombre qui caractérise l'acidité d'une solution. Plus le pH est faible,
plus le milieu est acide.
Polymérisation
assemblage de plusieurs motifs moléculaires qui donne une
macromolécule.
Pompe
appareil destiné à déplacer un liquide,
P o m p e à ion
pompe qui envoie des ions.
Prélèvement
prise de matière effectuée d'un milieu à des fins d'analyse.
Pression
rapport existant entre une force et une surface.
Protide
substance azotée contenant des acides aminés.
Proton
nucléon qui fait partie du noyau et chargé positivement.
Respiration
au niveau d'un organisme, action d'absorber du dioxygène et de
rejeter du dioxyde de carbone au niveau cellulaire. Dégradation
complète d'une substance organique.
R u p t u r e d e liaison
c'est lorsque l'on brise une liaison de covalence entre différents
atomes d'une molécule.
Seuil de réaction
point ou la réaction débute.
Solution
solution alcaline assurant la stabilité de l'équilibre acide-base.
Mélange de différentes substances visant à assurer la stabilité du pH
d'un milieu.
tampon
Spécificité
Spectre
d ' a b s o r p t i o n c'est l'ensemble des couleurs absorbées par un élément.
Température
Test
une réaction est dite spécifique d'un élément si et seulement si le
réactif agit sur un élément unique.
quantité d'énergie libérée au cours de réactions exothermiques.
d ' i d e n t i f i c a t i o n test qui permet de démontrer la présence d'éléments comme des ions,
des glucides.
LA TRANSMISSION DE L'INFORMATION
DANS L'ORGANISME
Logiciels de simulation en physiologie nerveuse
M. Dreyer, J.C. Hervé, N. Salamé
Nous sommes particulièrement
redevables à :
- MM. CREMEL, SARLIEVE, VINCENDON, Unité Neurochimie Normale et Pathologique
(U44 de l'INSERM), Strasbourg
- MM. SCHLICHTER, SELTZ, Institut de Physiologie, Université Louis Pasteur, Strasbourg
- M. PENNEC, Laboratoire de Physiologie Animale, Université de Brest
- M. d'ALCHE, Laboratoire de Biologie Animale et de Bio-informatique, Université de Caen
LA TRANSMISSION DE L'INFORMATION DANS L'ORGANISME
L o g i c i e l s d e s i m u l a t i o n en p h y s i o l o g i e n e r v e u s e
253
M. Dreyer, J.C. Hervé, N., Salamé
I. L'EVOLUTION DES CONTENUS
253
IL LOGICIELS DISPONIBLES EN PHYSIOLOGIE NERVEUSE
255
A. Fonctions générales des logiciels
1. HHE
2. AXOVACS
3. NEUROSIM
B. Fonctions communes, fonctions spécifiques
C. Etude comparée de quelques résultats expérimentaux
D. Autres logiciels disponibles
O . ETUDE DU SYSTEME NERVEUX AVEC LE LOGICIEL NEUROSIM
A. Problématique générale
B. Prérequis des élèves
C. Les étapes de la démarche
1. Le concept de potentiel d'action
2. La période réfractaire
3. Recherche des mécanismes ioniques
à l'origine du potentiel d'action
4. Recherche d'explications aux caractéristiques essentielles
du signal nerveux
5. Modalités de passage des ions Sodium et Potassium
au cours du potentiel d'action
6. Introduction à la notion de canaux ioniques
7. La conduction du message nerveux
8. La transmission de l'information au niveau des synapses
et le rôle intégrateur du neurone
IV. APPROCHES COMPLEMENTAIRES
A. Phénomènes ioniques de la membrane neuronale
B. Les aspects énergétiques
C. Les aspects moléculaires
256
256
257
259
261
262
263
263
264
265
265
265
267
268
270
272
275
275
277
281
281
284
285
LA TRANSMISSION DE L'INFORMATION DANS
L'ORGANISME
Logiciels de simulation en physiologie nerveuse
I. L'EVOLUTION DES CONTENUS
Au cours des dernières décennies l'étude du système nerveux a connu dans
les programmes d'enseignement des lycées une évolution qui suit, en raccourci,
l'évolution des connaissances scientifiques dans ce domaine. Dans les années
1970 l'anatomie comparée de l'encéphale, l'anatomie de la moelle épinière, la
structure des nerfs et la forme des neurones occupaient une place importante
dans les programmes. Ces études étaient complétées par celles, plus
descriptives que fonctionnelles, de l'œil, du muscle squelettique et du muscle
cardiaque. Les propriétés du nerf sciatique de grenouille étaient étudiées en
démonstration devant les élèves avec une chaîne de stimulation et un
oscillographe cathodique. On définissait la notion de seuil d'excitabilité, le
potentiel d'action, la conduction d'un nerf. On pouvait ainsi aboutir à la notion
de voies réflexes et de motricité volontaire. Ainsi se mettaient en place des
connaissances de base sur le système nerveux : une étude assez détaillée des
structures, quelques éléments de physiologie. On abordait aussi la régulation
neurohormonale : l'hypophyse et l'hypothalamus étaient des organes qui
faisaient le lien entre le système nerveux et la voie sanguine. On accordait une
certaine place au plan historique : la théorie d'un système nerveux continu
opposée à celle, bien établie, d'un système nerveux discontinu c'est à dire
neuronal.
Mais ces contenus des programmes ont très rapidement évolué dans le sens
d'une étude plus fine des structures (synapses vues au microscope
électronique), des mécanismes (phénomènes ioniques et membranaires
accompagnant la naissance et le déplacement du potentiel d'action, rôle des
neurotranmetteurs). Les travaux actuels de recherche font appel à des
techniques microscopiques. Le meilleur exemple est la technique du patch
clamp qui consiste à détacher un fragment de membrane cellulaire à l'aide d'un
micropipette et à étudier, par le biais des courants ioniques, le comportement
d'un canal isolé dans différentes conditions expérimentales.
Ces canaux ont un rôle fondamental dans la vie de la cellule : naissance et
propagation des influx nerveux dans les neurones et les cellules musculaires,
transformation des stimuli physiques et chimiques en signaux électriques dans
les organes sensoriels, communication avec le milieu extracellulaire.
A une autre échelle on essaie de comprendre le fonctionnement du système
nerveux en imaginant des réseaux de neurones dont on essaie de simuler le
fonctionnement avec un ordinateur.
Dans les laboratoires d'électrophysiologie et de neurophysiologie sensorielle
que nous avons visités à Grenoble (Laboratoire de biologie animale) et à Lyon
(Laboratoire d'électrophysiologie et de physiologie neurosensorielle), sont
actuellement étudiés : rôle du bâtonnet dans la transformation du message en
influx nerveux, la transmission membranaire et de la réponse musculaire, la
transmission du message olfactif par la cellule mitrale du bulbe rachidien, la
transmission de l'influx nerveux dans la cellule musculaire jusqu'à la réponse
mécanique. Les contacts qui ont été pris avec des organismes de recherche
(Unité 44 de l ' I N S E R M ) à Strasbourg montrent que la structure de la
membrane cellulaire et les propriétés de ses constituants sont au centre des
thèmes de recherche actuels qui abordent : les synapses à acétylcholine
(synthèse et modalités de libération de l'acétylcholine, structure e^
fonctionnement du récepteur postsynaptique, effet de diverses substances
modifiant le fonctionnement de la synapse), la myasthénie, l'insuline
(connaissances actuelles sur le récepteur), l'adrénaline (un exemple
d'amplification du signal, le récepteur adrénergique, le mécanisme d'action
d'une hormone).
Ces explorations font apparaître, d'une part le rôle fondamental de la
membrane et des propriétés de certains constituants (protéines) dans tous ces
exemples, d'autre part le rôle des ions (du calcium en particulier ) dans
certains mécanismes. Il se dégage clairement de l'ensemble de ces recherches
une grande unité de fonctionnement des mécanismes de transfert de
l'information à travers la membrane et dans le cytoplasme.
Une partie des connaissances scientifiques actuelles figurent déjà dans les
manuels scolaires. Il manque cependant des outils qui permettent de conduire
une approche expérimentale. La nature des nouvelles connaissances à enseigner
nécessite une évolution des activités pratiques avec les élèves : l'anatomie et
l'histologie ont perdu de leur importance tout en restant indispensables à la
compréhension de la physiologie. On observe toujours, on dessine moins.
L'oscillographe cathodique a été pendant des années un outil irremplaçable
pour montrer la naissance du potentiel d'action et sa conduction le long du nerf
sciatique de la grenouille. L'expérimentation assistée par ordinateur permet de
continuer dans cette voie là avec l'avantage de pouvoir sauvegarder les
résultats expérimentaux pour une meilleure exploitation avec les élèves.
En revanche, on ne dispose pas du matériel d'expérimentation pour étudier
le potentiel de repos, le potentiel d'action, la conduction sur des fibres
nerveuses isolées (micromanipulateur, micro-électrodes, fibre d'axone géant
de Calmar). Or toutes ces études peuvent être abordées à l'aide de logiciels
dont le modèle mathématique donne des résultats proches de la réalité. La
répétition des expériences, la rapidité d'obtention des résultats, l'affichage
graphique, en font des outils d'une grande souplesse.
Divers types de logiciels sont utilisés dans le domaine de la
neurophysiologie. Dans une première partie, nous passons en revue quelques
uns de ces logiciels ; nous consacrons la seconde partie à l'analyse d'une
utilisation pédagogique possible basée sur l'un d'entre eux. Nous envisageons
dans une troisième et dernière partie quelques approches qui pourraient
compléter cet enseignement sur plusieurs plans : neurochimie synaptique,
aspects énergétiques, dimension moléculaire.
II. L O G I C I E L S D I S P O N I B L E S E N P H Y S I O L O G I E N E R V E U S E
La plupart de ces logiciels logiciels portent sur le potentiel d'action et
utilisent un modèle basé sur un ensemble d'équations mises au point en 1953
par Hodgkin et Huxley à partir de résultats d'expériences faites sur l'axone
géant de Calmar. Ces résultats ont été obtenus en imposant un potentiel à la
membrane et en enregistrant les courants qui la traversent. Dans ce modèle la
membrane est assimilée à un circuit électrique comportant des résistances aux
ions sodium, potassium, chlore. Ces résistances sont variables dans le cas du
sodium et du potassium (en électrophysiologie on utilise la conductance (G) qui
est l'inverse de la résistance : G = 1/R); elles sont traversées par des courants
ioniques (I) qui dépendent du potentiel imposé à la membrane. A l'aide des
résultats expérimentaux, Hodgkin et Huxley ont pu définir les équations de la
conductance aux ions sodium et potassium. Ils ont introduit dans ces équations
des paramètres sans dimension ("portes" n et h pour le sodium, m pour le
potassium), m et n sont des paramètres d'activation et pourraient correspondre
à des protéines qui, sous l'effet du changement de potentiel, ouvrent
respectivement les canaux sodiques et potassiques, h est un paramètre
d'inactivation qui correspond à un autre état de la protéine du canal sodium au
cours du potentiel d'action.
Nous avons analysé de manière détaillée trois de ces logiciels : H H E
développé par le Laboratoire de physiologie animale et de bio-informatique de
l'université de Caen, A X O V A C S commercialisé par Axon Instruments et
N E U R O S I M commercialisé par B I O S O F T . Ces logiciels sont utilisés
principalement dans l'enseignement supérieur.
A. Fonctions générales des logiciels
H H E , A X O V A C S et N E U R O S I M
1.
HHE
Ce logiciel comprend plusieurs modules auxquels on accède par un menu qui
comprend les options suivantes :
- Conductance : module de base pour l'étude du potentiel d'action, affichage
du potentiel, de la stimulation et des conductances,
- M.N.H : module de base pour l'étude du potentiel d'action, affichage du
potentiel, de la stimulation et de l'état des portes,
- Tableau des valeurs : affichage en colonnes des valeurs de tous les
paramètres de la dernière expérience réalisée,
- Seuil : recherche du seuil d'excitation,
- Stimulus de longue durée : application d'un courant de longue durée, on
obtient une succession de potentiels d'actions dont la fréquence dépend de
l'amplitude du stimulus,
- Climalyse : le courant de stimulation s'établit progressivement au cours du
temps, à partir d'une certaine amplitude on obtient le potentiel d'action,
- Période réfractaire : étude de la réponse si on porte deux stimulations plus
ou moins rapprochées,
- Accommodation : on impose une stimulation sous-liminaire à partir du
temps t pendant x secondes, au temps t+x on applique une stimulation supraliminaire,
- Excitation (hyperpolarisation) : modification du potentiel de membrane si
la membrane est hyperpolarisée,
- Voltage-clamp : le potentiel est imposé à la membrane et on suit les
courants sodique, potassique, total,
- Voltage-clamp (GNA) : le potentiel est imposé à la membrane et on affiche
la conductance au sodium,
- Voltage-clamp (GK) : le potentiel est imposé un voltage à la membrane et
on affiche la conductance au potassium.
Dans tous ces modules l'écran graphique a la même présentation générale
(fig. D.
Al(uA/cm2)=lW
ESP-idem M-menu
0
1
D 1 ( m s ) = .1
I-imprimante
2
3
DL(ms)=8
A2(uA/cm2)=8
RETURN-suite
4
5
6
7
»2(ms)=B
Université - CAEN
8
9
18 ms
Fig. L- Ecran graphique de HHE.
2. AXOVACS
Ce logiciel comprend une dizaine de modules qui sont accessibles
directement ou par le biais de menus. Le menu principal donne accès à tous les
modules qui sont répartis dans deux menus partiels.AXOVACSl (fig. 2) est un
menu simplifié pour l'initiation comprenant les modules suivants :
- le potentiel d'action (simulation de base),
- l'affichage du potentiel d'action avec des échelles dilatées (effet zoom),
- la pharmacologie (influences de substances bloquant les canaux à sodium ei
potassium) ; les substances utilisées sont la saxitoxine (STX) et le tétraéthylammonium (TEA) ; l'étude est quantitative ; (l'option pharmacologie, dans
A X O V A C S 2 , permet la suppression de l'inactivation du canal sodium, la
Pronase),
- les conductances (du sodium et du potassium),
- les canaux (simulation de l'ouverture de canaux simples).
i C ) 13S7 ftxon 3 «str«i^erds, 3 ne ,
A computer simulation, based on the model proposed by
Hodgkin & Huxley [J. Physiol. 117.508 (1953)] for
génération of the action potential in the squid giant axon.
Nine options are available:
MOLTAGE CLAMP
(1) Channels
( 2 ) Conductances
(3) Currents
(Simulation of single channel gating)
(Macroscopic Na and K conductances)
CMacroscopic currents)
CURRENT CLAMP
(4)
Action potential
(5) Expanded scales
C6) Adaptation
(7) Pharmacology
(8) Ion substitution
(The basic simulation)
(A close look at threshold)
(Répétitive firing behauior)
(Spécifie blockade of Na or K channels)
(Change external Na or K concentration)
OR: (9)
(Exit to computer's opérâting System)
Quit
Enter your choice Cl, 2,
3, 4 , 5, 6, 7, 8, or 9)?
|
Fig. 2.- Menu principal d'AXOVACSl.
L'écran de travail principal permet l'affectation de nouvelles valeurs aux
paramètres et l'affichage des tracés (fig. 3).
INITIAL
MEMBRANE
POTENTIAL
mU=-6B
•68
•38
si
-38
SECOND
STIMULUS
uA=8
msec=8
start=8
-68
H
G
FIRST
STIMULUS
uA=188
msec=.1
start=8
K
ANOTHER RUN
(Y/N)? a
STin
~1
18
Fig. 3.- Ecran graphique d'AXOVACS.
3. NEUROSIM
Ce logiciel est subdivisé en quatre modules totalement indépendants au
niveau de leur exécution, basés sur l'utilisation de différents modèles
présentant une bonne ergonomie :
- étude du potentiel d'action nerveux,
- la conduction axonale passive : mise en évidence et propriétés des
variations localisées du potentiel de membrane pour des stimulations
infraliminaires,
- le fonctionnement synaptique: présentation de 4 types de synapses
excitatrices et inhibitrices avec la possibilité de simuler des interactions,
- modélisation d'un réseau neuronal simple: 5 neurones présentant une
activité spontanée qui peuvent être inhibés selon un schéma crée par
l'utilisateur.
Les écrans principaux de chacun de ces modules ont la même présentation.
L'écran principal du premier module (fig. 4) permet d'obtenir :
- l'enregistrement de la réponse électrique de l'axone aux stimulations,
- les courants ioniques consécutifs à ces stimulations,
- les variations de la conductance aux ions sodium et potassium.
EXPERIMENTAL PARAHETERS
N
u o l t a g e clamp (Y = on, N = off):
Je
m
c
«
g
i
r
â
M
t
s
1
Experlisent
Mo<ïei
t o g g l e Clantp
stietUIus
druGs
Ion c o n c s
toggle tRaces
0isplay scales
Uie« s c r e e n
T««e programme
Save p a r a e t e t e r s
Load p a r a e t e t e r s
t i m u l u s ( u o l t a g e clamp OFF)
ist
2nd
58.8
258.8
8.25
8.25
7.88 ms
ampl itude :
width:
interval :
rugs applied
TTX:
TEA:
ueratridine:
N
N
N
jNa:
;K:
418
18
uA
ms
mM
mM
oïij N
off)
features
Na
K
total
conductance:
Y
Y
ionic current: Y
Y
stimulus current:
uoltage display range
48 to
timebase:
18 ms
isplay
ip/dofem <PjfER>> o r I s t c h a r a c t e r .
Fig. 4.- Ecran principal de NEUROSIM.
ESC t o q u i t .
scale
58
1888
588
-88
Les paramètres sur lesquels on peut agir sont :
- l'activation ou désactivation du voltage imposé,
- le choix des paramètres de stimulation (durée en millisecondes, intensité en
microampères, intervalle entre deux stimulations). La position de la première
stimulation est fixe sur l'échelle des temps.
- l'introduction de drogues : le programme propose les suivantes : la
Tétrodotoxine (ou TTX), le Tétraéthylammonium (ou TE A ) , la Vératidrine).
L'étude est uniquement qualitative. On suppose donc que la quantité de drogue
utilisée est supérieure au seuil.
- la modification de la concentration ionique externe en sodium et en
potassium.
Il est également possible de choisir l'affichage ou non de certains
paramètres : affichage de la réponse électrique seule, de la conductance au
sodium ou au potassium, des courants ioniques sodiques, potassiques, totaux.
On peut aussi déterminer librement les échelles d'affichage du potentiel
d'action, de la conductance, des courants ioniques et du temps.
Le lancement de la simulation avec les valeurs attribuées aux paramètres se
traduit par l'affichage de diverses courbes sur un écran graphique. Un curseur
est disponible dont le positionnement sur un point quelconque de l'une des
courbes permet de lire instantanément la valeur de ce point (les compteurs de
toutes les courbes sont mis à jour mais seule est à lire la valeur correspondant
à la courbe sur laquelle est le curseur) (fig. 5 ) .
•48
Fl = HELP
F2 = Prt Scrn
U
KmU)
r
588
st in
(utV
cm2)
-88
- 8
|1888 ~
OUT
I
(utV
CM2)
[-58
G
(roS/
cm2)
1888 IN
tinte 8.8 ms
5.8
Fig. 5.- Ecran graphique de NEUROSIM.
18.8
cursor a va i1ab1e
c = clear & returnj
ESC = r e t u m
use arrous to
steer cursor
step =
1
(adjust uith •/-)
tinte
U
I
G
stim
=
=
=
=
=
18.88
19
3676
215
753
ms
mU
uA
mS
uA
we»bra.«e p o t e n t 3
Jcurr/cond
L'option Model associe à l'affichage des courbes précédentes celui d'un
"dessin animé" qui présente l'état des portes m, n, h au cours du potentiel
d'action, (fig. 6).
i k - return
ESC to cancel print
Heitane Potential
tîwe =10,00 ms
c = ciear * mm,
\
f\
Membrane Gates Model
M M N
Na
bhannel
nrrr
Single Channel Conductance
high
low
Na
bhannel
outside
JLIXJL
n nn n
wewbrane
inside
K
high
low
JL
Fig. 6.- Le modèle animé de NEUROSIM.
Ce logiciel permet également de sauvegarder des données expérimentales ou
de charger des données préalablement stockées. Chaque fois que l'on retourne
au menu principal, l'écran graphique est sauvegardé en mémoire. Dans
certains cas (si on veut modifier les valeurs de certains paramètres, les échelles
par exemple, ou bien basculer en voltage clamp) il faut effacer cette page
graphique. Autrement le logiciel permet l'affichage des courbes en
superposition.
Avec ces différents modules on peut simuler la plupart des résultats
expérimentaux de neurophysiologie : seuil d'excitation, période réfractaire,
activité répétitive à la suite de l'application d'un courant de longue durée, etc.
B. Fonctions communes, fonctions spécifiques
- Dans les trois logiciels la stimulation est de type rectangulaire: on choisit
sa durée (en millisecondes) et son intensité (en ^ampère par cm ),
2
- le potentiel d'action n'est pas propagé : on simule l'enregistrement dans la
zone de stimulation,
- la durée maximale peut être déterminée par l'utilisateur dans NEUROSIM et
dans certains modules d'AXOVACS,
- AXOVACS offre la possibilité de superposer la conductance et les portes
m,n,h et de déplacer sur l'échelle des temps la première stimulation,
- NEUROSIM, qui se caractérise en outre par une très grande rapidité dans
l'affichage des résultats, présente en propre plusieurs fonctions :
- la modification des échelles d'affichage,
- la visualisation du modèle en fonctionnement,
- la sauvegarde des conditions expérimentales.
C. Etude comparée de quelques résultats expérimentaux
La rapidité d'obtention des résultats avec ces logiciels nous a incités ï
entreprendre une étude comparative basée sur la recherche du seuil d'intensité
et sur l'apparition du pic du potentiel d'action. D'autres comparaisons, comme
l'effet des concentrations ioniques n'ont pas été possibles car HHE n'a pas cette
option et AXOVACS prend en compte le rapport des concentrations intérieure et
extérieure alors que NEUROSIM affiche la concentration extérieure effective.
Cette remarque vaut également pour l'effet des drogues: étude non abordée par
HHE, quantitative pour AXOVACS, qualitative pour NEUROSIM.
Exemple 1 :
Recherche du seuil d'intensité minimale nécessaire pour obtenir un potentiel
d'action:
Conditions de stimulation :
- Durée :
- Amplitude :
- HHE
- AXOVACS
- NEUROSIM
0.1 milliseconde
2
64.67 |aA/cm
64
|iA/cm
45.2 n A / c m
2
2
Exemple 2 :
Temps au bout duquel apparaît le pic du potentiel d'action pour une
stimulation de 70 |jA/cm2 durant 0.1 milliseconde :
- HHE
- AXOVACS
- NEUROSIM
3.7 ms
3.0 ms
1.86 ms
Les deux résultats retenus montrent une assez grande parenté entre HHE et
Le modèle du logiciel N E U R O S I M a un seuil de réponse plus bas
bien qu'il fasse appel, comme les deux autres, aux travaux de Hodgkin et
Huxley.
AXOVACS.
D. Autres logiciels disponibles
Il existe bien d'autres programmes de physiologie nerveuse qui tournent sur
les matériels disponibles dans les lycées :
- FIBRE N E R V E U S E : Logiciel permettant l'étude du potentiel de repos, de la
semi-perméabilité de la membrane, du mécanisme de transport du sodium et
du potassium ainsi que du potentiel d'action, des courants ioniques, avec
schéma du fonctionnement des canaux voltage-dépendants. Paru en 1991, ce
logiciel est maintenant bien connu (se rapporter à la documentation).
- un ensemble de programmes réalisés au Laboratoire de Physiologie
animale de Brest, qui comporte notamment les modules suivants :
- N G R : simulation de neurogramme biphasique
l'enregistrement obtenu avec un nerf sciatique isolé,
analogue
à
- HH : simulation du potentiel d'action nerveux basé sur les équations
d'Hodgkin et de Huxley. Etude des courants en potentiel imposé et effet de la
tétrodotoxine et du Manganèse.
- PATCH : Approche de la théorie probabiliste de l'ouverture des canaux
ioniques. Complète le module précédent.
- d'autres logiciels concernent le fonctionnement neuronique. T H A L A M
(Université de Yale), par exemple, modélise le comportement électrique d'un
neurone. On peut expérimenter en voltage clamp ou en current clamp à l'aide
de deux électrodes : l'une enregistre le potentiel membranaire, l'autre sert à
injecter du courant. Possibilité de faire agir des drogues ou des
neuromédiateurs.
III. E T U D E D U S Y S T E M E N E R V E U X A V E C L E L O G I C I E L N E U R O S I M
Parmi les différents logiciels analysés, NEUROSIM nous semble actuellement
l'outil de modélisation le plus souple pour aborder la plupart des notions de
neurophysiologie que nous avons à enseigner pour les raison suivantes :
- grande facilité de mise en oeuvre,
- interface conviviale, bonne ergonomie (utilisation de fenêtres
d'affichage),
- rapidité d'exécution et d'affichage,
- existence d'un modèle de fonctionnement des "portes",
- sauvegarde des résultats et donc possibilité de constituer une
bibliothèque d'expériences types,
- ouverture sur d'autres aspects que le potentiel d'action
- la conduction passive,
- le fonctionnement synaptique,
- les réseaux neuroniques.
A. Problématique générale
Dans le système nerveux, les neurones forment un réseau complexe,
cytologiquement discontinu où circulent des flux d'informations. Les points
principaux à étudier sont les suivants :
- comment naît le message nerveux ?
- quel est le mécanisme de la conduction ?
- comment le message est-il codé le long de la fibre nerveuse ?
- comment les multiples informations qui affluent vers un neurone
sont-elles traitées par celui-ci traitement qui conduit à l'émission d'un
message codé en fréquence de potentiels d'action ?
- le concept de réseau neuronique.
B. Prérequis des élèves
1. Histologie et cytologie : les élèves sont censés connaître la structure du
tissu nerveux, le concept de neurone, la structure de la membrane plasmique.
2. Electrophysiologie : les élèves doivent connaître :
- l'existence du potentiel de membrane (ou potentiel de repos) lié aux
différences de concentrations ioniques entre les milieux extra et intracellulaire,
et à la perméabilité différentielle de la membrane du neurone aux ions
(membrane plus perméable aux ions potassium qu'au ions sodium et chlore
imperméable aux ions organiques intracellulaires).
- la notion de potentiel d'équilibre pour un ion donné ; on considère qu'il
s'agit d'un cas idéal pour lequel la membrane est uniquement perméable à cet
ion ; ce potentiel d'équilibre dépend du rapport de concentration pour cet ion
des milieux extra et intracellulaires.
- le fait que les membranes cellulaires sont perméables à plusieurs ions; le
potentiel de membrane est proche du potentiel d'équilibre de l'ion pour lequel
la membrane est le plus perméable.
- le fait que la différence entre le potentiel d'équilibre et le potentiel de
membrane pour un ion donné engendre un transport passif de cet ion dans le
sens du gradient électrochimique,
+
+
- l'existence de transports actifs (pompe N a K ) qui compensent les
passages passifs d'ions N a et K et maintiennent ainsi les différences de
concentration entre les milieux intra et extracellulaires.
+
+
C. Les étapes de la démarche
1. Le concept de potentiel d'action
En se limitant aux manifestations électriques, quelles sont les caractéristiques
de la réponse de l'axone aux stimulations ?
Méthode : on demande aux élèves de provoquer une stimulation et
d'observer les modifications du potentiel de membrane. Dans certaines
conditions de stimulation apparaît une inversion rapide mais transitoire du
potentiel de membrane: le potentiel d'action.
Ceci doit conduire l'élève aux notions suivantes :
- description du tracé de la réponse : temps de latence, dépolarisation,
repolarisation, hyperpolarisation (fig. 7).
+40
U
KmU)
~ 500
stim
(uA/
cm2)
0
11000
OUT
I
(uA/
cm2)
50
G
|1000 —I
IN
CRl2)
<L
time 0.0 ms
Fig. 7.- Potentiel
d'action.
5.0
0
10.0
- Le seuil de dépolarisation et la loi du tout ou rien : l'existence d'un seuil de
dépolarisation est mise en évidence en faisant varier la durée et l'intensité des
stimulations (fig. 8).
•48 -,
+
V
|(mU)
r
588
s t im
(uA/
cm2)
-88
8
|1888
OUT
I
(uA/
cm2)
58
G
|1888
IN
(mS/
cm2)
time 8.8 ms
Fig. 8.- Seuil
5.8
18.8
d'excitabilité.
Dans le cas d'une stimulation efficace, l'amplitude du potentiel d'action reste
constante quelles que soient la durée et l'amplitude de la stimulation. Le signal
nerveux répond à la loi du tout ou rien. On peut aussi se demander s'il existe
une relation entre la durée et l'amplitude de la stimulation. Considérant une
durée de stimulation donnée, on explore l'échelle des amplitudes de stimulation
pour obtenir un potentiel d'action.
Durée
(milliseconde)
0.05
0.1
0.2
0.3
0.4
0.5
0.6
0.7
0.8
0.9
1.0
Amplitude de stimulation Produit
Durée x Amplitude
(microampère/cm )
67.7
45.2
26.9
53.8
17.1
51.3
12.4
49.6
10.5
52.5
9.1
54.6
7.6
53.2
6.8
54.4
6.0
54.0
5.5
55.0
2
ampl i tude
(HfVcm
2
)
—i
1
1
1
1
1
1
0.1
0.2
0.3
0.4
0.5
0.6
0.7
1
0.8
1 1—
0.9
1.0
duréeCmsec)
Fig. 9.- Courbe d'excitabilité de la fibre
nerveuse.
Dans la partie moyenne, le produit durée-amplitude est relativement
constant. Il faut par conséquent une certaine quantité de courant pour
déclencher le potentiel d'action. En deçà des valeurs limites du tracé le
potentiel d'action n'apparaît plus quelle que soit la durée de la stimulation.
2
Exemple : Amplitude : 1.7 ^iA/cm ; durée : 30 ms.
2. La période réfractaire
+48
-,
time
6.B
ms
18.6
Fig. 10.- Période réfractaire : deux stimulations,
durée 0,25 ms.
28.8
amplitude : 300
2
/jA/cm ,
La figure 10 montre que la réponse de la membrane à une deuxième
stimulation dépend de l'intervalle de temps qui existe entre les deux
stimulations. La période réfractaire comprend deux zones : la période
réfractaire absolue (si le délai est inférieur à 2 ms) au cours de laquelle la
fibre ne répond pas, et la période réfractaire relative : une dépolarisation plus
importante est nécessaire pour l'émission d'un autre potentiel d'action.
On constate que durant la période réfractaire la conductance au sodium est
diminuée, alors que la conductance au potassium ne semble pas affectée. On
peut émettre l'hypothèse que les structures membranaires responsable de
l'entrée du sodium et du potassium sont différentes.
3. Recherche des mécanismes ioniques à l'origine du potentiel d'action
On part des constatations suivantes : au pic du potentiel d'action, le potentiel
membranaire est proche du potentiel d'équilibre du Na+ ; au moment de
l'hyperpolarisation, le potentiel membranaire est très voisin du potentiel
d'équilibre du K+.
Cela suggère que le potentiel d'action résulte de transports ioniques passifs
engendrés par des changement de perméabilité membranaire aux ions.
Le logiciel permet de tester cette hypothèse en analysant les changements de
conductance aux ions corrélés avec le potentiel d'action, et les conséquences
sur le potentiel d'action de changements de concentrations en ions N a et K+ du
milieu extracellulaire.
+
- Diminution de la concentration du sodium extracellulaire (fig. 11).
-i
•48
(mU)
>
-88
stim
(uA/
cm2)
-
1888 ~|
OUT
(uA/
cm2)
1888
IN
[-58
G
(mS/
cm2)
-
ii^Êêfe
I
tlwe
8.8
<_ e
ws
18.8
28.9
Fig. 1 1 . - Effet d'une diminution
de la concentration
Stimulation : amplitude 50 /jA/cm , durée 0,25 ms. K .
2
+
|
en
sodium.
Résultat : le pic du potentiel d'action s'abaisse si la concentration en sodium
diminue et le potentiel disparaît vers 20 milliMole.
Conclusion : le potentiel d'action est bien déclenché par l'entrée des ions
sodium. Cette entrée est passive et obéit aux lois de la diffusion.
- Augmentation de la concentration potassique externe (fig. 12) :
Fig. 12.- Effet d'une augmentation de la concentration
en
Stimulation : amplitude 100 |iA/cm , durée 0,15 ms. Na+ normal.
potassium.
2
Résultat : on constate que le retour au potentiel de repos ne se fait plus si la
concentration extérieure en potassium augmente. En effet la diminution du
gradient de concentration des ions potassium limite la sortie de ces ions.
Conclusion : Une modification de la concentration externe de sodium ou de
potassium a des effets sur l'excitabilité de la fibre nerveuse. Le maintien des
gradients de concentration sodique et potassique est fondamental dans
l'expression de la réponse. Toute modification du milieu extracellulaire risque
de perturber la transmission de l'influx nerveux.
270
TRANSMISSION DE L7NFORMATTON DANS L'ORGANISME-----.....- - - - - - -
- Absence de toute stimulation (fig. 13) :
Un axone plongé dans un milieu dont la concentration en potassium est
augmentée (1,5 fois par exemple) subit des dépolarisations spontanées.
+4E1
+
1\
IJ
(mlJ)
f \
/ l
-_/
-BEI
\~_....
[
SEIEI
stim
~:~~
time'EI.EI ms
Fig. 13.- Dépolarisations spontanées. Pas de stimulation, K+ 15 mM, Na+
normal.
En effet, une augmentation de la concentration en ions K + du milieu
extracellulaire fait que le potentiel membranaire devient négatif et proche du
seuil de dépolarisation.
4. Recherche d'explications aux caractéristiques essentielles du signal
nerveux·
La question à aborder est de rechercher la cause à l'origine des changements
de perméabilité membranaire aux ions Na+ et K+. La nécessité d'une
dépolarisation minimale (seuil de dépolarisation) pour engendrer un potentiel
d'action laisse à penser que ces changements sont engendrés par la
dépolarisation. On peut le tester par l'option "Voltage imposé".
La technique du voltage imposé (voltage clamp) consiste à appliquer à la
membrane un potentiel fixe et à étudier les courants qui la traversent durant
l'application de ce potentiel.
- Exemple 1 (fig. 14) :
+
fig 14 .- Voltage clamp. Ions K+ normal, Na
normal.
Au moment où un potentiel est appliqué à la membrane (et dépolarise
l'axone) apparaît un courant global entrant puis sortant, qui est la somme de
deux courants : un bref courant entrant de sodium, un courant sortant de
potassium, plus lent, mais qui se prolonge tant que le potentiel imposé est
maintenu.
Pour des valeurs normales de concentration les courants sodiques et
potassiques ont, au moment de l'installation du potentiel de clamp, les mêmes
caractéristiques que lors de l'apparition du potentiel d'action. Tout se passe
comme si l'apparition de ces courants était la conséquence de la chute rapide
du potentiel de membrane. Cette chute peut être déclenchée par le potentiel
imposé ou par une stimulation qui apporte des charges négatives à l'extérieur.
Dans ce dernier cas il y a naissance d'un potentiel d'action.
- Exemple 2 : effet de la diminution de la concentration du sodium
intracellulaire (fig. 15).
Quand on applique le potentiel, le courant sodique est plus faible. Le courant
potassique n'est pas affecté par la modification du courant sodique. On en
déduit que :
- le flux net d'ions obéit constamment aux lois de la diffusion,
- la diffusion des ions potassium est indépendante de celle des ions
sodium.
•78
-i
4-
U (mU)
188
1588
PUT
n
I
cm2)
[1588 _ l
IN
(-88
G
(«S/
cm2)
:<L 8
time 8.8 ms
18.8
28.8
Fig. 15.- Voltage clamp. Ions K+ normal, Na+ 60 mM.
5. Modalités de passage des ions sodium et potassium au cours du potentiel
d'action.
Rappeler aux élèves la structure de la membrane cellulaire : une double
couche de phospholipides (globalement hydrophobes), des molécules de
protéines (hydrophiles) ; les ions étant hydratés, ils ne pourront traverser la
membrane qu'au niveau des protéines (rappeler le diamètre des ions sodium et
potassium).
Hypothèse : il y a dans la membrane des protéines organisées en canaux
assurant le passage des ions sodium et potassium.
Ces canaux appelés voltage-dépendants par rapport aux canaux de fuite du
potentiel de repos seraient sensibles aux toxines alors que les canaux de fuite ne
le sont pas. Il doit être possible de perturber le fonctionnement des canaux
voltage-dépendants avec des substances chimiques à effet pharmacologique.
- Recherche des caractéristiques de l'action de drogues sur le signal nerveux.
- L'adjonction de TEA permet l'apparition du potentiel d'action mais le
retour au potentiel de repos ne se fait plus. La conductance au sodium évolue
normalement ce qui confirme que le pic du potentiel est bien dû au sodium.
Par contre la conductance au potassium est nulle ; le potassium ne peut quitter
la membrane.
+88 - .
u
r
knU)
588
stin
(uA/
cm2)
-88
<L_ 0
11888 ~
OUT
I
(uA/
cm2)
58
G
(«S/
(1888 IN
cm2)
<L8
t i m e 8 . 8 ms
18.8
' 28.8
7EA. Stimulation : amplitude 50 fjA/cm ,
2
Fig. 16.- rfw
Na normal.
durée 0,25 ms.
+
- action de la TTX (fig. 17) : la TTX empêche l'apparition du potentiel
d'action. On voit aussi que la conductance au sodium reste nulle. Dans ce cas
de figure, la conductance au potassium ne varie pas : celle-ci n'augmente que si
le potentiel d'action apparaît.
Fig. 17.- Effet de la Tétrodoxine.
durée 0,25 ms. Na normal.
+
Stimulation
: amplitude
50
2
fiA/cm ,
274
TRANSMISSION DE L7NFORMAT/ON DANS L'ORGANISME-------
- action de la Vératidrine (fig. 18) : La Vératidrine maintient la
dépolarisation ainsi que la conductance pour les ions sodium et potassium. La
dépolarisation et la conductance sont bien liées.
j
+88
U
IIU)
j
-88
~}
(WV
ca2)
r. "--· _· · · ·
+
i
r
i
r-
i
1
l1li8
1"
!
_----------
.. J....-.--
f
l~
(oaS/
ca2)
8
28.8
tl_....o-::-8-.8-_-----~1-8-.8-----~
Fig. 18.- Effet de la Vératridine. Stimulation: amplitude 50 pA/cm2, durée
0,25 ms.
- Voltage clamp et drogues :
Les expériences en voltage clamp confirment l'effet des drogues: le courant
potassique disparaît avec le TEA (fig 19).
:;:)]
J": "~"'"
+
.... · · . ··· ...· .. ········. · ..· ·...1
-,~
188
----- - --18.8
.
[~
28.8
Fig. 19.- Voltage Clamp. Ions K+ normal Na+ normal, drogue TEA.
6. Introduction à la notion de canaux ioniques
L'action des poisons qui modifient spécifiquement la conductance aux ions
sodium et potassium est un argument en faveur l'existence de canaux, zones de
passage privilégiées pour les ions sodium et potassium. La T T X bloque les
canaux sodiques, le TEA bloque les canaux potassiques. Ces canaux s'ouvrent
s'il y a diminution du potentiel de membrane. Ceci est un argument pour
montrer que l'ouverture des canaux à potassium est v o l t a g e dépendant, (rappelons que la sortie du potassium participe à la repolarisation de
la membrane)
a. Le modèle des portes
Le modèle de Hodgkin et Huxley prend en compte des modifications de
charges électriques au niveau de la membrane. Ces modifications sont
assimilées à des "portes". On peut établir la relation entre la conductance et
l'état de ces portes au cours du potentiel d'action. Ces portes pourraient bien
correspondre à des entités chimiques sensibles à la valeur du potentiel
transmembranaire. Il y a deux types de portes associées aux canaux du Na
(portes m, h), un type associé aux canaux du K (porte n). Ces entités chimiques
pourraient correspondre aux molécules des canaux ioniques.
b. Le comportement aléatoire de l'ouverture des canaux
L'animation qui illustre les états d'un canal (fig. 6) donne une idée de l'état
des portes et de l'état ouvert ou fermé d'un canal au cours du potentiel
d'action. Si on suit l'état de ce canal au cours de plusieurs potentiels d'action
obtenus dans les mêmes conditions expérimentales, on remarque que ce canal
ne s'ouvre pas à tous les coups. Cette observation illustre le comportement
aléatoire de l'ouverture des canaux voltage-dépendants.
7. La conduction du message nerveux
a. La conduction passive
Une stimulation infraliminaire crée une perturbation temporaire du
potentiel de membrane (potentiel électrotonique) Le module C A B L E du
logiciel permet d'étudier la propagation de ce potentiel Ce module simule les
propriétés d'un neurone à conduction passive, sans pic de potentiel. La
situation expérimentale simulée est la suivante : quatre électrodes sont insérées
dans un axone infiniment long. Une électrode sert à injecter un courant
rectangulaire positif dont on peut faire varier l'amplitude et la durée, trois
électrodes (El, E2, E3) enregistrent la réponse de l'axone et sont positionnées
à une certaine distance de l'électrode excitatrice. Les caractéristiques de la
membrane sont modifiables ainsi que le diamètre de l'axone. Nous proposons
l'étude de l'effet d'une stimulation infraliminaire sur le potentiel intracellulaire
en fonction de l'intensité de la stimulation et de la distance des électrodes.
276
TRANSMISSION DE L7NFORMATlON DANS L'ORGANISME-------
- Expérience 1 (fig. 20) : cette expérience montre qu'une stimulation
infraliminaire crée une variation du potentiel de membrane dont les effets
diminuent quand on s'éloigne du site de stimulation.
+
.8
wN
r" \
•8
1\
1
r-+
.::. '\.
- . -..-
1
"
5.8
.... <>'"
!
"p
l
nA
••
"~
..... .
..................
1. . ' ._~_.~_.-. . _=-.:!. _._. - _. _.
8.8 _
: . ._~:~:.::::::::::.~.::::::::.:::=:::::.=-.::===
18.8
2.5
28.8
Fig. 20.- Potentiel électrotonique. Diamètre de l'axone 10 JD1l Electrodes
El, E2, E3.
- Expérience 2 (fig. 23) : plus le diamètre de l'axone est grand, moins le
potentiel électrotonique s'atténue avec la distance.
5.8
nA
2.5
8.8 _
18.8
28.8
Fig. 21.- Potentiel électrotonique. Diamètre de l'axone 5, 8, 10 JD1l.
Electrode El.
- Expérience 3 (fig. 22) : deux stimulations proches dans le temps ont un
effet cumulatif. Cette propriété est importante pour comprendre l'intégration
des messages nerveux par le neurone.
—•=
e.e
ms
Fig. 22.- Potentiels électrotoniques.
El, E2, E3. Délai 8 ms.
i
h
îe.e
ze.e
Diamètre de l'axone 10 jjm.
Electrodes
b. La conduction active
Cette propriété fondamentale des fibres nerveuses ne peut pas être étudiée
avec les logiciels présentés ici car les potentiels d'action ne sont pas propagés.
8. La transmission de l'information au niveau des synapses et le rôle
intégrateur du neurone
Le système nerveux comporte une multitude de neurones qui communiquent
entre eux par des contacts synaptiques. La plaque motrice est une synapse
cholinergique périphérique. Chaque fibre musculaire ne possède qu'une seule
plaque motrice et chaque potentiel de plaque motrice (PPM) est normalement
supraliminaire. En résumé: un potentiel d'action nerveux donne un potentiel de
plaque motrice qui donne un potentiel dans la fibre musculaire.
A l'opposé les neurones centraux reçoivent plusieurs milliers d'afférences
nerveuses axoniques formant autant de synapses. Le motoneurone de la
substance grise de la moelle épinière, par exemple, reçoit 6000 synapses
axosomatiques et axodendritiques dont les axones présynaptiques sont
d'origine centrale et périphérique. Les synapses sont de type chimique.
Le module P S P permet d'introduire cet aspect fondamental du
fonctionnement du système nerveux. Ce module propose l'étude de quatre
types de synapses centrales :
- synapse excitatrice avec augmentation de la conductance, type
cholinergique produisant un potentiel postsynaptique excitateur ( P P S E ) ,
nommée SI,
- synapse inhibitrice avec augmentation de la conductance, type
produisant un potentiel postsynaptique inhibiteur (PPSI), nommée S 2 ,
GABA,
- synapse excitatrice avec diminution de la conductance, type Sérotonine,
produisant un PPSE, nommée S3,
- synapse inhibitrice avec augmentation de la conductance,
nommée S4. Il s'agit d'inhibition présynaptique.
PPSI
dépolarisant,
Les paramètres expérimentaux sur lesquels on peut agir sont :
- le moment de l'activité de chacun des quatre types de synapses,
- l'activation répétitive de la synapse de type SI avec un facteur de
facilitation ,
1
- l'introduction d'un courant expérimental,
- le choix du seuil de dépolarisation,
- la modification des échelles (temps, potentiel, courant synaptique,
conductance).
La variation de potentiel mesurée concerne toujours la membrane
postsynaptique.
Nous nous limiterons dans cette étude, par souci de simplification vis à vis
des élèves, aux synapses SI et S2.
a. Etude d'une synapse excitatrice (fig. 23) : la stimulation unique d'une
synapse excitatrice (SI) diminue faiblement la valeur du potentiel de membrane
sans atteindre le seuil de dépolarisation.
1
II s'agit d'une potentialisation de la réponse postsynaptique qui apparaît lorsque l'élément
présynaptique décharge avec une fréquence élevée. A partir d'une certaine fréquence, les
potentiels d'action successifs engendrent des réponses postsynaptiques ayant une amplitude
plus grande que celle enregistrée avec un potentiel d'action isolé.
Fig. 23.- Potentiel postsynaptique
SI.
excitateur (PPSE). Activité de la synapse
b. Etude d'une synapse inhibitrice (fig. 24) : la stimulation unique d'une
synapse inhibitrice (S2) augmente faiblement la valeur du potentiel de
membrane, il y a hyperpolarisation.
Fig. 24.- Potentiel postsynaptique
inhibiteur (PPSI).
c. Stimulation répétée d'une synapse excitatrice (fig. 25) : si la fréquence est
suffisante et le facteur de facilitation bien choisi, on peut provoquer la
naissance d'un potentiel d'action.
j
-28
il
U
(nU)
-68 -
-188
58
expnt
stin
B
<
(nA)
158 ~
OUT
syn
I
158
IN
^
-58
•
1
r
n
>
-
n
Q
f
a
t i ne 8 . 0 mB
n
15.0
~5.8
G
(uS)
8
38.8
Fig. 25.- Activité répétée de la synapse SI.
d. Effet de l'activité de la synapse S2 sur l'apparition du potentiel d'action
(fig. 26). L'étude comparée des documents 25 et 26 met en évidence qu'il
suffit d'un seul PPSI pour retarder l'apparition d'un potentiel d'action.
-28 _
y
(nU)
-68 ->
w
-188
58
expat
stin
—8
(nft)
158 ~
OUT
syn _
-58
1
>
(TlA)
158 IN
A
t i Me 8 . 8 ns
i
\
fi
n
<i
n
n lil
nt
15.8
f
-5.0
G
(uS)
8
38.8
Fig. 26.- Activité répétée de la synapse SI. Effet d'une activité de la synapse
S2 à 20 secondes.
Cette expérience illustre la complexité de la réponse neuronale quand
plusieurs milliers de synapses sont susceptibles de fonctionner en même temps.
Synthèse : dans leur grande majorité les P P S E et les P P S I sont
infraliminaires, pour chacun d'eux la dépolarisation reste très localisée. La
naissance du potentiel d'action axonal résulte de l'activité des différents types
de synapses à un moment donné, plus précisément de l'effet cumulatif des PPSE
et soustractif des PPSI en liaison avec leur distribution spatiale. Dans le cas du
motoneurone la résultante de ces activités (ou PPSE global) s'exerce au niveau
du segment initial de l'axone, là où le seuil d'excitabilité est le plus faible. Si le
seuil est atteint il y a émission d'un train de potentiels d'action dont la
fréquence dépend de l'amplitude du potentiel global postsynaptique.
Cette étude est d'une importance fondamentale pour la compréhension des
propriétés intégratrices du neurone dans le système nerveux central.
Ce type d'étude met en évidence la complexité du fonctionnement du
système nerveux. L'étude électrophysiologique ne peut être dissociée, d'une
part, des connaissances sur la structure de la membrane, d'autres part des
propriétés des molécules de la communication interneuronale : les
neuromédiateurs.
Il serait souhaitable de pouvoir introduire le concept de réseau neuronique.
Le module N E T W O R K nous semble trop simplifié pour étudier cette question
car le réseau comprend au maximum 5 neurones qui ont tous une activité
spontanée. Les potentiels d'action véhiculés par les axones aboutissent à des
synapses axosomatiques inhibitrices. L'utilisateur a cependant le choix des
différentes connexions. Les possibilités offertes par ce module restent limitées
(une nouvelle version du logiciel, parue en septembre 1992, permet de
travailler sur une cinquantaine de neurones).
IV. A P P R O C H E S
COMPLEMENTAIRES
A. Phénomènes ioniques de la membrane neuronale
L'exploration des outils disponibles n'a pas mis en évidence l'existence de
modélisation du fonctionnement de la membrane du neurone au cours du
potentiel d'action ou de la synapse au cours de la transmission de l'information
à ce niveau. Il apparaît que les aspects électrophysiologiques sont bien
développés mais que les phénomènes membranaires et biochimiques le sont peu
(bien que N E U R O S I M présente cependant un modèle avec les trois "portes" et
FIBRE N E R V E U S E un schéma du fonctionnement des canaux voltagedépendants.
Enfin, le fonctionnement de la jonction neuro-musculaire, la synapse la
mieux connue des chercheurs n'a, à notre connaissance, jamais été modélisée.
La modélisation de cette synapse permettrait d'étudier le mécanisme de la
transmission synaptique de manière interactive en définissant pas à pas les
modalités du passage de l'information à travers l'espace synaptique. Ceci
mettrait en évidence :
- que la discontinuité cytologique crée une discontinuité dans la conduction
de l'information nerveuse ; cette notion pourrait être atteinte en plaçant des
microélectrodes réceptrices avant la synapse (sur l'axone), de part et d'autre de
l'espace synaptique et au-delà de la synapse (sur la fibre musculaire),
- l'existence d'un neuromédiateur. L'étude de dysfonctionnements
pathologiques (myasthénie) ou expérimentaux (à l'aide de venins de serpents et
de drogues) permettrait de montrer les conditions nécessaires au passage de
l'information,
- les différentes étapes de cette transmission :
- arrivée du potentiel d'action au niveau du bouton synaptique,
- ouverture des canaux calcium voltage-dépendants,
- libération du contenu des vésicules dans l'espace synaptique et entrée
des ions C a dans l'axone présynaptique,
+
- ouverture des canaux cationiques postsynaptiques : — > potentiel de
plaque
> potentiel d'action musculaire.
Tous ces événements devraient être illustrés à différentes échelles (la
synapse dans sa totalité, l'échelle membranaire avec les mouvements ioniques,
l'échelle du canal ionique). Les données quantitatives et qualitatives concernant
la jonction neuro-musculaire sont nombreuses mais souvent variables ce qui
complique la réalisation d'un modèle. Voici quelques données, à titre
d'exemple :
- Stockage de l'acétylcholine : elle est stockée dans des vésicules
synaptiques de 40 nm de diamètre situées dans les terminaisons nerveuses
Chaque vésicule peur contenir entre 1000 et 10000 molécules d'acétylcholine.
- En l'absence de toute stimulation du motoneurone il y a un
phénomène d'exocytose spontanée qui provoque de petites dépolarisations
d'amplitude 0,5 à 1 mV insuffisantes cependant pour atteindre le seuil de
déclenchement d'un potentiel.
- La libération du contenu d'une vésicule constitue un "quantum" qui
ouvre 3000 canaux ioniques, ce qui est suffisant pour dépolariser une zone de
la membrane d'environ 1 mV.
- Un potentiel déclenche l'exocytose de 300 vésicules environ.
- Un canal Na ouvert permet le passage de 15000 à 30000 ions Na par
milliseconde
- Le nombre de récepteurs par plaque motrice est estimé à 17 E
7
2
- Il y a 10000 canaux par fim .
- 0,3 ms après la libération d'un paquet d'acétylcholine, 2000 canaux à
sodium et potassium sont ouverts.
- La concentration d'Acétylcholine dans la fente synaptique est :
9
- au repos : 10 E ~ moles/litre,
4
_ 3
- en activité : 10 E ~ à moles/litre ; cette augmentation de
concentration se fait en 1 milliseconde.
2
- Un quantum couvre une surface de 1 \im et ouvre 50 à 7 5 % des
canaux.
- La concentration d'acétycholinestérase dans l'espace synaptique est
de 10 E 7,
- Une molécule d'acétylcholinestérase hydrolyse 25000 molécules
d'acétylcholine par seconde.
- L'acétylcholinestérase détruit environ 1/3 de l'acétylcholine au cours
de son passage dans l'espace synaptique.
En ce qui concerne les venins de serpent ou d'autres poisons les données sont
qualitatives. Ces effets sont de deux types : (A) paralysie flasque des muscles
squelettiques, (B) tremblements musculaires avec paralysie. Les modes d'action
peuvent être classés ainsi : (1) fixation au récepteur d'Acétylcholine, (2) blocage
de la libération de l'Acétylcholine, (3) inhibition de l'activité de l'Acétylcholinestérase, (4) facilitation de la libération de l'Acétylcholine. Voici
quelques exemples de fonctionnements anormaux :
EFFET
MODE D'ACTION
Venin d'Hydrophiidae
A
1
Venin du Bungare d'Asie
A
2
Venin du Cobra australien
A
1 et 2
Venin du Mamba
B
3
Toxine botulinique
A
2
Enfin la structure du récepteur nicotinique musculaire est la mieux connue
car l'organe électrique de certains poissons (Raie mantha) est constitué de
quelques milliers de cellules comportant de fortes concentrations de ce type de
récepteur.
Ce récepteur a été purifié, isolé et sa structure primaire déterminée. Il
comprend quatre polypeptides différents et sa masse est comprise entre
250 000 et 270 000. Des études en microscopie électronique de cristaux plan
ont permis de voir que le récepteur a un diamètre de 9 nm et qu'il possède une
ouverture centrale de 2 nm de diamètre. Il traverse la bicouche
phospholipidique de la membrane cellulaire, fait saillie de 7 nm dans l'espace
extracellulaire et de 3 nm dans le cytoplasme. Des mesures de perméabilité ont
mis en évidence que les ions Na+ et K+ hydratés passent. Le diamètre réel de ce
canal doit être compris entre 0,65 et 0,85 nm.
Nous n'avons pas pu, dans le cadre de cette recherche, aller jusqu'à une
tentative de modélisation.
B. Les aspects énergétiques
Le rôle fondamental du calcium dans le fonctionnement des synapses et de la
fibre musculaire suggère que des travaux pratiques de spectrophotométrie
pourraient compléter ces études. Des travaux pratiques pourraient illustrer
certaines modalités du passage de cet ion à travers une membrane : gradient de
concentration, besoins énergétiques (ATP). Nous avons retenu la mitochondrie
(organite présent dans la synapse et dans la fibre musculaire), dont la matrice
est un réservoir de calcium. Pourraient ainsi être étudiés :
- les variations de la consommation d'oxygène sous l'action de différentes
substances (le succinate, l'ADP),
- la mesure des échanges de calcium entre la mitochondrie et le milieu
"extérieur" en relation avec l'activité mitochondriale. Cette manipulation, mise
au point avec un chercheur de l'unité 44 de l'INSERM, fonctionne de manière
très satisfaisante.
- le dosage des protéines de la mitochondrie.
Si pour le premier point on peut s'appuyer, par exemple, sur le réacteur
E S A O de Jeulin, en revanche, un spectrophotomètre de précision est requis
pour les deux derniers points : les performances des spectrophotomètres
actuellement accessibles sont insuffisantes car la fenêtre de lecture n'est pas
assez fine.
C. Les aspects moléculaires
Il s'agit là d'un thème transversal et unificateur car il concerne le rôle joué
par les protéines membranaires dans la transmission de l'information en
général. Les récepteurs postsynaptiques des neuromédiateurs formant les
canaux ioniques en sont un exemple. Cette problématique est proche de celle
des récepteurs hormonaux et aussi des enzymes extra et intracellulaires car la
structure spatiale de toutes ces protéines joue un rôle fondamental dans la
réalisation de leur fonction.
Nous faisons souvent appel dans notre enseignement à un nombre varié de
molécules organiques. Dans le but de brosser un tableau d'ensemble d'une
molécule et de la resituer dans son contexte biologique, il serait intéressant de
disposer d'informations rapidement accessibles, telles que : nom, masse
molaire, formule brute, formule développée, nature chimique, propriétés
chimiques, représentation dans l'espace, origine, localisation, fonction
biologique, utilisation par l'homme, etc. Nous avons commencé, sous D B A S E la
constitution d'une banque de données qui concerne pour le moment 85
molécules : des glucides, les acides aminés, des acides gras, les bases azotées
des acides nucléiques, des hormones, les pigments chlorophylliens.
Isolée, cette base peut avoir quelques utilisations limitées : l'étude comparée
des acides aminés et des glucides (constater la présence d'azote et quelquefois
de soufre dans les acides aminés) ; l'extraction des hormones polypeptidiques
(constater qu'il s'agit presque toujours de petits polypeptides). Les limites sont
dues en particulier à l'impossibilité d'y associer la représentation moléculaire.
S'il est possible de représenter actuellement sur les compatibles PC des
molécules de l'ordre de 1000 atomes, l'évolution de la puissance des matériels
informatiques permet d'espérer, à court terme, l'utilisation d'outils de
représentation de molécules complexes : protéines dont les modèles prennent
en compte des problèmes d'énergie libre et d'entropie.
BIBLIOGRAPHIE
OUVRAGES
ALBERTS B., BRAY D. (1986) - Biologie moléculaire de la cellule, Paris, FLAMMARION.
BAULIEU E-E. (1978) - Hormones, Paris, HERMANN.
BOULIAC B., SIMONNET G., VINCENT J-D. (1981) - Synapses et transmission chimique,
Paris, SANDOZ EDITIONS.
BURGEAT ,KAYSER , Biophysiologie du neurone, Paris, MASSON
CHANGEUX J-P. (1983) - L'Homme neuronal, Paris, FAYARD.
D A R N E L L J., LODISH H., BALTIMORE D. (1988) - La Cellule : biologie moléculaire,
Paris, VIGOT.
H A M M O N D C , TRITSCH S. (1990) - Neurobiologie cellulaire, Paris, DOIN,
LAGET , Biologie et physiologie des éléments nerveux, Paris, MASSON,
ROBERTS M., MATTHEW B., LEVY (1988) - Physiology, The C.V Mosby company St
Louis, Washington, D.C. Toronto.
S C H M I D T , D U D E L , JÀNIG, Z I M M E R M A N N (1984) - Neurophysiologie, Paris,
LIBRAIRIE LE FRANÇOIS.
ARTICLES:
D'ALCHE P., CHARON M., Simulation sur microrordinateur du potentiel d'action nerveux à
l'aide des équations de Hodgkin et Huxley, Biopédagos, n ° l , p. 65-77, 1986.
AUGUSTINE G., sodium action in synaptic transmitter release, Ann. Rev. Neuroscience, p.
633-693, 1987.
BERRIDGE M., Les molécules de la communication dans la cellule, Pour la Science, n° 98, p.
134-147, 1985.
BERTRAND G., Spectrophotométrie, Encyclopaedia Universalis, vol. 15, p. 240-244, 1968
BOCKAERT J., Les récepteurs membranaires, La Recherche, n° 179 , p. 892-900, 1986.
BRETSCHER M., Les molécules de la membrane cellulaire, Pour la Science, n° 98, p. 66-78,
1985.
CARAFOLI E., CROMPTON M., MALMSTRÔM K., SIGEL E., SALZMANN M., CHIESï
M., AFFOLTER H., Mitochondrial Calcium Transport and the Intracellular Calcium
Homeostasis, Biochemistry of Membrane Transport, Springer-Verlag Berlin Heidelberg New
York, p. 535- 551, 1977
LLINAS R., Le rôle des ions calcium dans la transmission synaptique, Pour la Science, p. 90
102, décembre 1982.
MENEZ A., Les venins des Serpents, La Recherche, n° 190, p. 886- 893, 1987.
PEPER K., BRADLEY R.J., DREYER F., The Acetylcholine Receptor at the Neuromuscular
Junction, Physiological Reviews, vol. 62 n° 4 p. 1271-1340, 1982
POPOT J-L., La structure des protéines membranaires, La Recherche, n° 192, p. 1170-1181,
1987.
SNYDER S., Les molécules des échanges entre les cellules, Pour la Science, n° 98, p. 94-105,
1985.
Structure du muscle squelettique, CRDP Rennes, p. 21-37.
Le signal calcium, Pour la Science, p. 78-88, janvier 1986.
Récepteurs membranaires, Médecine-Sciences, p. 40-48, déc. 1988.
M. DREYER, J.C. HERVE, N. SALAME, Analyse de quelques logiciels de neurophysiologie
utilisés dans l'enseignement supérieur. Académie de Versailles, CARFI, 1992, p.
Tables scientifiques, Documenta Geigy, Bâle, J.R. Geigy S.A., Département pharmaceutique,
1963.
ANALYSE D E S E Q U E N C E S
D E G E N E S E T DE P R O T E I N E S
J. C. Hervé, D. Lenne, J.F. Rodes
N. Salamé, B. Thérrié
Ce travail est redevable à :
M. ADOUTTE, Laboratoire de Biologie Cellulaire 4, Université Paris XI
M. GOUJET, Muséum National d'Histoire Naturelle
M. GOUY, Unité Biométrie, Génétique et Biologie des Populations, Université Claude
Bernard, Lyon
M. KREISS, Institut National de Recherche sur le Cancer, Villejuif
M. LECOINTRE, Muséum National d'Histoire Naturelle
M. PHILIPPE, Laboratoire de Biologie Cellulaire 4, Université Paris XI
M. RISLER, Centre de Génétique Moléculaire, Gif Sur Yvette
Ainsi qu'aux enseignants qui ont participé
logiciels avec leurs classes :
à la mise au point et à l'utilisation
MMes BARBIER et PELLETIER, Lycée Evariste Galois, Sartrouville
MM. BARRERE et DUPONT , Lycée Paul Louis Courier, Tours
MM. FAURE et SCHMIT, Lycée Antoine De Saint Exupéry, Fameck
MMes LEBRETON et DUMANT, Lycée Parc des Loges, Evry
M. COSTES, Lycée Camille Claudel, Vauréal
M. LESUR, Lycée Janson de Sailly, Paris
M. MARGERIE, Lycée International, Saint Germain en Laye
Mme MARRE, Lycée Le Corbusier, Poissy
M. MASSE, Lycée Gérard de Nerval, Uzarches
Mme MERIGUET, Lycée françois 1er, Fontainebleau
Mme PEDUZZI, Lycée Romain Rolland, Ivry
M. POIBLAUD, Lycée Georges Clemenceau, Reims
Mme RICHERME, Lycée François Villon, Les Mureaux
expérimentale
des
a
288
P ê
e
ANALYSE D E SEQUENCES DE GENES ET DE PROTEINES
J. C. Hervé, D. Lenne, J.F. Rodes, N. Salamé, B. Thérrîé
289
I - L'EVOLUTION DES CONNAISSANCES
289
A. Quelques repères historiques
B. Les connaissances de biologie moléculaire
dans les programmes des lycées
C. Conséquences pédagogiques
IL BANQUES DE DONNEES ET LOGICIELS DE TRAITEMENT
EN BIOLOGIE MOLECULAIRE
A. Les bases de données internationales
B. Les traitements des séquences
C. Les choix opérés dans les logiciels disponibles
III. ENSEIGNER LES CONNAISSANCES DE BASE
AVEC UN LOGICIEL D'ANALYSE DE SEQUENCES (SEQAIDII)
A. Fonctionnalités du logiciel
1. Lecture, écriture, visualisation de séquences
2. Edition et conversion de séquences
3. La comparaison (alignement) de séquences
4. Analyse de séquences
B. Banque de données associée à SEQAIDII
1. Constitution de la banque
2. Contenu de la banque
C. Les thèmes d'utilisations du logiciel et des données
1. Code génétique : caractéristiques, cadre de lecture
2. L'ARN messager
3. Activités autour du gène eucaryote
4. Allèles du gène, mutations et conséquences
5. Familles multigéniques et complexification du génome
D. Les utilisations en classe
IV. ETUDIER L'EVOLUTION A PARTIR
DE DONNEES MOLECULAIRES
A. Fonctionnalités du logiciel EVOLUTION MOLECULAIRE
1. Choix des espèces
2. Travail sur des séquences non alignées
3. Travail sur des séquences alignées
a. Calcul et affichage d'une matrice des distances
b. Calcul et affichage d'un arbre phylogénétique
c. Comparaison de deux matrices
B. Utilisations pédagogiques
1. Familiarisation avec la classification phylogénétique des vertébrés
2. Notions d'homologie, de mutation et de contrainte fonctionnelle
3. Réponses à un problème de parenté entre groupes
4. Rythme d'évolution des molécules chez les vertébrés
5. Réalisation de quelques phylogénies
6. Duplication de gènes
V. CONCLUSIONS ET PERSPECTIVES
289
291
292
294
294
296
297
298
298
299
301
303
306
307
307
308
310
311
312
315
315
316
319
328
329
331
332
332
333
333
334
334
336
336
337
338
339
341
342
ANALYSE DE SEQUENCES
DE GENES ET DE PROTEINES
I - L'EVOLUTION DES
CONNAISSANCES
A. Quelques repères historiques
La théorie cellulaire, la théorie de l'évolution, la découverte par Mendel des
gènes, entités abstraites responsables des caractères observables des
organismes, sont des avancées majeures de la biologie du 19ème siècle. Avec la
théorie chromosomique de l'hérédité, établie durant les deux premières
décennies du 20ème siècle, qui conduit à localiser les gènes de façon précise
sur les chromosomes, cela représente le noyau dur de la biologie.
Pendant toute la première moitié du 20ème siècle, ces concepts unificateurs
vont rester relativement étrangers l'un à l'autre. Peu à peu, les biochimistes
vont élucider les complexes voies métaboliques qui, au sein des cellules,
assurent la synthèse des différentes molécules à partir des nutriments ainsi que
les mécanismes des conversions énergétiques. Ils vont mettre en évidence le
rôle des enzymes en tant qu'agents indispensables du métabolisme et prendre
conscience de leur nature protéique. Il faut toutefois attendre les années
quarante pour que se conceptualisent les premières idées sur la liaison entre les
gènes et les réactions du métabolisme cellulaire, liaison résumée alors par
l'expression "un gène une enzyme". C'est aussi au milieu du 20ème siècle que
la théorie synthétique de l'évolution réunit dans un même cadre explicatif
sélection naturelle et génétique des populations.
Mais, faute de connaître la nature des gènes, on n'est au milieu de ce 20ème
siècle qu'aux prémisses de la biologie moléculaire. L'élucidation de la structure
de l'ADN, en 1953, marque le début d'une période où vont être clarifiés les
mécanismes par lesquels les caractéristiques phénotypiques des êtres vivants
résultent de l'expression des informations contenues dans leurs gènes :
transcription et traduction des gènes, code génétique.
Cette période qui s'étend jusqu'à la fin des années soixante, marque la
véritable naissance de la biologie moléculaire, résultat de la jonction entre la
biochimie et la génétique. Ces découvertes sur la nature et les modalités
d'expression des gènes représentent sur le plan conceptuel une avancée
considérable, mais elles sont peu opérationnelles. On sait qu'un gène est
constitué d'ADN, mais comment isoler puis analyser dans l'immense chaîne
nucléotidique qui constitue une molécule d ' A D N , la petite région qui
correspond à un gène ? Au début des années 1970 les gènes restaient des
abstractions. La mise au point des techniques du génie génétique entraîne une
nouvelle révolution en biologie, en fournissant une méthode générale de
purification des gènes et de détermination de leurs séquences. Depuis la fin des
années 1970, le nombre de gènes dont la localisation chromosomique et la
séquence sont déterminées croit à un rythme rapide. Le programme génome
humain doit déboucher sur l'inventaire des 100 000 gènes humains.
Cette connaissance moléculaire des organismes, en particulier de l'Homme, a
des retombées dans les branches les plus diverses de la biologie. Sans tomber
dans le réductionisme, on peut dire que la biologie moléculaire fait désormais
partie de la neurophysiologie, de l'endocrinologie, de l'immunologie, de
l'embryologie, etc. Comme la révolution intervenue est d'essence
technologique, elle s'est rapidement traduite par des applications dans le
domaine médical. Il est désormais possible de faire une analyse génétique d'une
personne à tous les niveaux de développement avec toutes les conséquences qui
peuvent en découler (diagnostic prénatal, médecine prédictive, etc.). C'est le
début d'une nouvelle génétique qui soulève des problèmes éthiques importants.
L'histoire évolutive des organismes est enregistrée dans leurs gènes. La
connaissance de plus en plus poussée des génomes des organismes éclaire les
processus de l'évolution. En particulier, la comparaison des gènes homologues
des diverses espèces permet de révéler des apparentements, d'établir des
phylogénies. Surtout, la dynamique des génomes et donc les possibilités de
création de "nouveautés" génétiques, apparaissent beaucoup plus grandes que ce
que l'on croyait (duplication de gènes, gènes résultant d'une réassociation
d'exons, etc.).
B. Les connaissances de biologie moléculaire dans les programmes
des lycées
Les programmes de 1966 marquent l'introduction des notions de biologie
moléculaire dans l'enseignement secondaire. En effet, en terminale D, à propos
de la division cellulaire, on trouve : la duplication du matériel chromosomique
et la synthèse de l'ADN ; dans une autre partie du programme portant sur la
génétique et l'évolution on demande d'envisager les étapes récentes de la
génétique : Beadle et Tatum et la correspondance "un gène une enzyme" ;
Watson et Crick, la structure de l'ADN et le code génétique ; Lwoff, Monod et
Jacob et l'exploitation de l'information génétique. Ces programmes, avec
l'introduction des découvertes majeures des décennies 50 et 60 en biologie
moléculaire traduisent la première modernisation de l'enseignement de la
biologie au lycée. Malgré tout, les notions introduites sont davantage
juxtaposées aux données classiques qu'intégrées. Elles représentent un ajout et
la liaison entre le génome présent au sein de chaque cellule et le phénotype des
organismes n'est pas vraiment abordée.
Cette juxtaposition se retrouve, moins accentuée, dans les programmes de
1982 : l'ADN est envisagé au cours de la reproduction conforme, la notion de
gène et de code génétique lors de l'étude de l'hérédité à l'échelle de
l'organisme, la synthèse des protéines à propos de la biologie cellulaire. Il faut
attendre les programmes de 1988 pour une intégration cohérente et synthétique
de la biologie moléculaire en terminale : transmission, nature, expression de
l'information génétique. Ces programmes traduisent aussi l'exploitation des
données récentes sur la structure des génomes des êtres vivants en proposant
l'étude de l'évolution à l'échelle des molécules (les parentés moléculaires).
Dans le cadre de la réforme des lycées, le nouveau programme de première
S applicable à la rentrée 1993, associe matière énergie et information
génétique. Il s'agit de comprendre comment le programme génétique, présent
dans l'oeuf et ensuite répliqué dans toutes les cellules de l'organisme, régit au
cours de la construction et du renouvellement permanent de l'organisme
l'exploitation de la matière et de l'énergie empruntées au milieu. En s'appuyant
sur des exemples précis, il est demandé de faire la liaison entre le génotype
d'un organisme et certaines de ses caractéristiques phénotypiques, d'expliquer
comment les différences au niveau des allèles des gènes entraînent des
différences au niveau des phénotypes. Le programme invite donc à utiliser les
connaissances récentes acquises sur la structure des gènes pour dégager des
modèles explicatifs de la relation génotype phénotype.
C. C o n s é q u e n c e s pédagogiques
Cette évolution dans les contenus et l'esprit des programmes enseignés au
lycée a de multiples conséquences pédagogiques positives ce qui n'exclut pas
l'existence de problèmes à résoudre.
D'abord, les connaissances en biologie moléculaire constituent un système
explicatif commun à beaucoup de mécanismes, ce qui permet de définir un
ensemble de notions auxquelles on se réfère de manière récurrente (concept de
programme génétique, universalité du code génétique, expression des gènes,
conséquences des mutations dans l'information génétique, reconnaissance
moléculaire basée sur les structures intervenant dans tous les aspects de la
communication dans l'organisme, etc.). A condition de bien cerner les concepts
indispensables, ceci simplifie d'une certaine manière l'enseignement de la
biologie et en augmente la cohérence.
En effet, les élèves retrouveront ces concepts en énergétique,
neurophysiologie, génétique humaine, immunologie, etc. L'effort initialement
consenti pour faire acquérir les notions de base s'en trouve ainsi largement
réinvesti.
Il convient de noter en second lieu que l'aspect abstrait, "mathématique" des
connaissances, qui est perçu parfois uniquement sous l'angle négatif, est en fait
cohérent avec la tonalité des autres enseignements scientifiques au lycée.
Depuis quelques années, beaucoup d'enseignants et d'élèves expriment leur
satisfaction de pouvoir approcher avec précision les explications qui
s'expriment par des lois et qui permettent donc des prédictions. Dans une
certaine mesure, le statut de l'enseignement de la biologie au lycée peut en être
changé.
Dans le registre des difficultés à pallier, il convient de souligner également
que les niveaux explicatifs actuels de nombreux phénomènes, font appel à des
connaissances diversifiées, qui se situent principalement dans le domaine de la
physique et de la biochimie. L'introduction de ces connaissances implique une
coordination des différentes disciplines (à travers la complémentarité de leurs
programmes). C'est le cas, par exemple, pour les conversions énergétiques au
sein des organismes vivants, qui obéissent aux lois de la physico-chimie tout en
gardant la spécificité de leur réalisation par ces organismes. Mais que ces
coordinations soient effectives ou non, les biologistes auront besoin, pour
s'appuyer sur ces notions, de s'assurer de leur maîtrise et le cas échéant
d'introduire les connaissances nécessaires afin de dispenser un enseignement au
niveau de formation scientifique visé.
Si on perçoit, dans l'ensemble, les signes d'une certaine adhésion à ces
évolutions, il faut admettre en revanche qu'il est quasiment impossible de
proposer aux élèves en biologie moléculaire des activités manipulatoires
formatrices. Cet état de fait n'est ni récent ni spécifique du domaine de la
biologie moléculaire : l'enseignement de la biologie et de la géologie est
devenu coutumier, depuis quelques décennies, de l'utilisation des techniques qui
aident à approcher et expliquer des phénomènes dont l'intérêt scientifique,
pédagogique et social n'est pas contesté, mais sur lesquels une action directe
n'est pas possible.
Pour faire face à cette situation bien connue en biologie moléculaire comme
dans les autres domaines, il est indispensable de rechercher des solutions qui
font accéder les élèves aux phénomènes et aux connaissances visés, notamment
à l'aide d'activités pratiques.
Ces activités, qui ne peuvent pas se réduire à la mise en oeuvre de procédés
techniques, doivent avoir pour objectifs de confronter les élèves avec des faits
sur lesquels peut s'exercer le raisonnement, de leur proposer de résoudre des
problèmes signifiants, de décrire quantitativement et de comprendre le plus
précisément possible les lois qui régissent les phénomènes biologiques.
En déterminant les séquences des gènes et des protéines pour de nombreux
organismes, les techniques de génie génétique ont contribué, dans une certaine
mesure, à conférer aux molécules, une dimension "palpable", concrète.
"Le gène était une abstraction nécessaire, un être de logique. Le voilà entré
dans la réalité moléculaire, le voici objet chimique. (...) (il) peut être
manipulé. Sa structure est connue. Elle peut être modifiée à volonté (...). Les
biologistes se trouvèrent en mesure de dépasser le caractère abstrait et formel
de la notion de gène pour pénétrer beaucoup plus avant leur structure et leur
mode de fonctionnement (...)"
(P. Kourilsky, Les Artisans de l'Hérédité)
Ces séquences constituent désormais des données de référence et des objets
réels d'observation, de quantification, d'analyse, etc., avec lesquels on peut,
notamment, mettre en relation génotype, phénotype moléculaire et phénotype
clinique. Constituées en bases de données internationales informatisées depuis
plus d'une décennie, ces séquences sont traitées avec des logiciels spécifiques
Données et programmes de traitement peuvent constituer des instruments
appropriés à l'enseignement, dans des conditions qu'il convient de déterminer
et sur lesquelles porte pour l'essentiel le travail exploratoire présenté ici.
II. B A N Q U E S D E D O N N E E S E T L O G I C I E L S D E T R A I T E M E N T
EN BIOLOGIE MOLECULAIRE
A. Les bases de données internationales
Au cours des années 60 et 70 des atlas et des ouvrages spécifiques sont
d'abord consacrés aux quelques dizaines puis quelques centaines de séquences
publiées dans la littérature (vers la fin des années 70, un millier de séquences
protéiques étaient publiées).
L'utilisation des moyens informatiques va suivre très rapidement l'évolution
des techniques en génie génétique et l'explosion du nombre de séquences
disponibles. Entre 1980 et 1985, des bases de données sont constituées aux
Etats Unis : GenBank, National Board and Research Fondation - Protein
Information Ressources (NBRF-PIR), NEW AT (banque de données protéiniques),
en Europe : European Molecular Biology Laboratory (EMBL), SWISS-Prot, et
au Japon : DNA Data Bank of Japan (DDBJ) puis International Protein
Information Databa in Japan (JIPID).
Les objectifs de ces bases sont de trois ordres : constituer des archives fiables
des données, en permettre la consultation et la manipulation en fonction de
différents critères, associer à ces données des outils d'analyse. Une coopération
est maintenant entamée entre ces différentes bases, pour homogénéiser les
formats, partager le travail de saisie des données et constituer peut-être à long
terme une seule base de données de référence.
Ces bases nucléiques, protéiques ou les deux, sont implantées sur de gros
systèmes informatiques, accessibles aux chercheurs de différentes manières : à
travers les réseaux de télécommunication, au moyen de mises à jour sur
CDROM, ou bien sous la forme d'extraits sur disquettes. Ces bases contiennent
maintenant des milliers de séquences ; au fur et à mesure que ce nombre
augmente, on constate une structuration en sous bases spécialisées, par
organisme par exemple.
Pour accéder à des séquences spécifiées, des systèmes d'interrogation sont
associés à chaque banque, qui utilisent différents critères de tri : numéro
d'enregistrement (souvent signalé dans certaines publications), Auteur (s),
Journal, organisme, caractéristiques, contenu des textes de commentaire, etc.
Chaque "entrée" ou item trouvé par l'équation de recherche contient un
ensemble d'informations associées à la séquence proprement dite. Presque
toutes les séquences des bases sont annotées.
Une partie des informations est destinée à retrouver les sources. Les
annotations les plus importantes concernent l'analyse de la séquence,
l'emplacement des différents signaux, des exons et des introns, la localisation
des éventuelles mutations, ainsi que d'autres particularités de la séquence.
Comme le E M B L gère simultanément des données nucléiques et protéiques, on
trouve signalé dans les commentaires concernant une séquence d ' A D N le
numéro d'accès à la protéine correspondante si celle-ci est archivée dans la
banque. Suit enfin la séquence proprement dite (fig. 1).
ID
XX
AC
XX
DT
DT
XX
DE
XX
KW
XX
OS
OC
OC
XX
RN
RP
RA
RT
RT
RT
RL
XX
DR
XX
CC
CC
CC
CC
CC
XX
FH
FH
FT
FT
FT
FT
FT
FT
FT
FT
FT
FT
FT
FT
FT
FT
FT
XX
SQ
HSH33G2
standard; DNA; PRI; 913 BP.
X05855; Y00108;
06-JUL-1989 (Rel. 20, Last updated, Version 1)
29-NOV-1987 (Rel. 14, Created)
Hunan histone H3.3 gene exon 2
histone H3.3.
Homo sapiens (human)
Eukaryota; Animalia; Metazoa; Chordata; Vertebrata; Mammalia;
Theria; Eutheria; Primates; Haplorhini; Catarrhini; Hominidae.
[1]
1-913
Wells D., Hoffman D., Kedes L.;
"Unusual structure, evolutionary conservation of non-coding
séquences and numerous pseudogenes characterize the human H3.3
histone multigene family";
Nucleic Acids Res. 15:2871-2889(1987).
SWISS-PROT; P06351; H33SHUMAN.
for histone H3.3 gene séquences see also:
exon 1 X05854
exon 3 X05856
exon 4 X05857
Data kindly reviewed (ll-May-1988) by Kedes L.
Key
Location/Quaiifiers
precursor_RNA
<1. .>913
/note="primary transcript"
<1. .472
/note="intron I"
109..109
/note="purine"
473. .623
/note="exon 2"
473..495
/note="5' UT-region"
496..623
/note="histone H3.3 (AA 1-43)
(623 is 2nd base in codon)"
624. .>913
/note="intron II"
intron
unsure
mRNA
misc_feature
CDS
intron
Séquence 913 BP; 269 A; 140 C; 193 G; 308 T; 3 other;
atattttcag atatttacag caatccatca acagteagae gaaggggggg
gggggggagt aagacctttt ttttgctgta atttgactcg accttccart
ttttttcttt tgacttgttt gtggatggaa tgtttacaga catttctaat
attaaataaa ttggatcaaa ggccgttcga ggtatttttg ttttgccgtt
aattggcatt ttgagaggtg attgatactg ctaacaattt tetagtaetc
aagaagagat tttgggtaga cgtaatcttc acctttcaaa ttatataaca
tattttttat actgatcata atttecagat ttggggaggg ggtgatcgtg
ttgtatgttt ggtagttgca tatggtgatt tttgattttt caatgctggt
ggaggtctct gtaccatggc tcgtacaaag cagactgccc gcaaatcgac
gcacccagga agcaactggc tacaaaagcc gctcgcaaga gtgcgccctc
gtgaagaaac ctcatcgtta caggtattaa aaaacaggaa aaaaatggga
ttgtatgtat ccatataatt taacaaaaag atggataaca ggaaaacttt
gaaacttttt tttttcattt gaacacttaa etaetgetta aataaatgta
atttatatat aaagttaagt attaggtttt attnaaacgt ttaactttna
ttacctggag gtctaaggag acetegtata tcactgataa tgttaatggg
attttagtta acc
Fig. 1.- Exemple de fiche descriptive
données du EMBL.
d'une séquence
cagccaaagt
ggtttgtgcc
taetgettta
tgtcgctcag
tagtttgttt
atacgaacat
gcaggaaaag
aggtaagtaa
cggtggtaaa
tactggaggg
caagtctctc
ttgctttaga
ctgtatgatc
agecataate
atatattgac
issue de la base de
B. Les traitements des séquences
En se référant aux exploitations que les chercheurs font de ces séquences, on
constate qu'il se dégage quelques approches principales qui concernent les
fonctions, les structures et l'évolution des molécules.
1. La comparaison de séquences : elle a pour but d'identifier des similitudes,
de les quantifier et d'évaluer si les ressemblances observées sont sensiblement
différentes d'une répartition aléatoire et se prêtent, dans ce cas, à la recherche
d'autres explications. Ces comparaisons ont pour objectifs, d'une part, de
retrouver des éléments ou des motifs communs entre les séquences, et d'autre
part "d'aligner" les séquences en calculant les positions des différents résidus
qui les composent de manière à obtenir le maximum de similitude. En
montrant des domaines de ressemblance et des similarités globales, on ouvre la
voie à des interprétations concernant les mécanismes explicatifs éventuels.
Cette opération d'alignement se fait manuellement de manière courante dans
les laboratoires de recherche quand elle n'implique qu'un nombre limité de
séquences courtes. L'utilisation de l'informatique est indispensable quand il
s'agit de rechercher les similitudes entre une séquence déterminée et des
ensembles de séquences déjà connues et archivées. La mise au point
d'algorithmes d'alignement multiples performants et d'indicateurs aidant à
l'évaluation fine des résultats mobilise encore nombre d'équipes de recherche.
2. L'analyse des séquences : ce domaine comporte plusieurs niveaux de
complexité. L'analyse peut se limiter à des descriptifs simples de la
composition d'une séquence (acides aminés ou codons utilisés, masse molaire,
etc.), opérer les conversions possibles entre différents types de séquences
(passage de l ' A D N à l ' A R N , traduction en protéine, etc.), porter sur la
recherche de signaux et de motifs particuliers (sites de restriction) et aider à
localiser des régions codantes.
Elle peut également viser la prédiction de structures : la conformation
spatiale de la molécule (structure secondaire, tertiaire, etc.), ainsi que les
évaluations qu'on peut calculer sur son caractère hydrophile ou hydrophobe,
sur son antigénicité, etc.
3. L'évolution moléculaire : la comparaison des séquences d'ADN et de
protéines et la quantification de leurs ressemblances ouvre en particulier la
voie à des analyses concernant les mécanismes de diversification du génome,
sur la conservation ou non des fonctions de certaines molécules compte tenu de
cette diversification, ainsi qu'à la construction d'arbres sur des bases
moléculaires pour rendre compte des filiations possibles entre les espèces.
C. Les choix opérés dans les logiciels disponibles
Les outils nécessaires à ces traitements sont en général associés aux banques
de données implantées sur de gros systèmes serveurs. Ils permettent ainsi de
réaliser à distance, la recherche de données, leur extraction et leur
exploitation. Les programmes de traitement regroupent souvent des modules et
des algorithmes mis au point par différents chercheurs un peu partout dans le
monde. Pratiquement tous les algoritmes de traitement utilisés ont fait l'objet
de publications. Les programmes réalisés sont donc souvent du domaine
public. En France, le système Bisance, implanté sur le serveur du Centre
Interuniversitaire de Traitement de l'Information (rue des Saints Pères, à
Paris) donne accès aux données de différentes banques (Genbank, E M B L , etc.)
et aux traitements à travers neuf menus principaux et un langage de
commande. Des systèmes d'interrogation similaires sont associés aux banques
de données sur le serveur même où elles sont implantées (Protéine Séquence
Query, par exemple, pour accéder aux données de NBRF-PIR).
Certains grands organismes de recherche possèdent leur propre jeu de
programmes qui sont constitués de centaines de modules correspondant aux
procédures et algorithmes mis au point progressivement.
Tant par leur richesse que par leur diversité et même hétérogénéité, ces
outils ne peuvent se prêter à un travail pédagogique utile au lycée. La plupart
d'entre eux ne comportent d'ailleurs pratiquement pas d'interface et ne sont
vraiment utilisables que par leurs auteurs.
Depuis quelques années, avec l'évolution technique, des logiciels plus ou
moins spécialisés sont écrits pour les micro-ordinateurs, reprenant parfois les
mêmes algorithmes implantés sur les gros systèmes. On trouve ainsi des
logiciels spécifiques pour la gestion de banques de séquences locales, les
conversions du format des données issues des grandes banques internationales,
l'aide au séquençage ou à la lecture d'électrophorèses, l'établissement de cartes
de restriction, le tracé de structures spatiales, l'alignement multiple, le calcul
d'arbres phylogénétiques, etc. Beaucoup de ces logiciels sont du domaine
public. D'autres logiciels regroupent certaines des fonctions spécifiques des
précédents. Certains de ces logiciels "généraux" sont des produits
commerciaux (cf. informations pratiques), alors que la diffusion de certains
autres, sans but lucratif, est autorisée (ils sont considérés comme étant du
domaine public).
Parmi ces logiciels, en tenant compte des programmes d'enseignement, nous
nous sommes intéressés d'une part aux logiciels d'analyse de séquences, et
d'autre part aux logiciels de construction de phylogénies écrits pour des microordinateurs compatibles PC.
Le logiciel SEQAIDII, présente l'intérêt d'être diffusé librement. Déjà utilisé
(et testé) par des chercheurs en France, il propose un nombre important de
fonctionnalités concernant l'alignement et l'analyse de séquences. D'ergonomie
un peu ancienne (déroulement par menus successifs) il a en revanche l'avantage
de fonctionner sur tous les équipements (avec écran monochrome ou en
couleur, sur disquette, etc.). Bien qu'il soit de syntaxe anglaise, nous avons
retenu ce logiciel comme outil de base pour concevoir les activités susceptibles
d'être proposées aux élèves en vue de la mise en pratique (et l'apprentissage)
de concepts fondamentaux en biologie moléculaire et d'une approche plus
précise de la génétique.
En ce qui concerne la construction de phylogénies, les logiciels classiques du
domaine (qui sont souvent aussi des logiciels d'alignement multiple) se
réduisent pour la plupart à des outils de calcul pratiquement sans interface
utilisateur et sans sorties aisément exploitables
Un nouveau logiciel de recherche en cours de développement au laboratoire
de biologie cellulaire de l'Université d'Orsay renouvelait ces outils en y
introduisant une dimension graphique importante et en y associant des fichiers
consistants de données (séquences nucléiques et protéiques) directement
exploitables. En accord avec les chercheurs, nous avons retenu l'option de
particiciper à la conception d'une version du logiciel adaptée à l'enseignement.
III. E N S E I G N E R L E S C O N N A I S S A N C E S D E B A S E A V E C U N L O G I C I E L
D ' A N A L Y S E D E S E Q U E N C E S (SEQAIDII)
Le travail de recherche a été basé totalement sur l'exploitation de la version
anglaise du logiciel. Au moment de la conception de ce rapport, la production
d'une version française est en cours de réalisation. Pour la lisibilité des
descriptions, les principales pages d'écran sont donc fournies en français,
sachant néanmoins que cette version n'est pas encore stabilisée.
A. Fonctionnalités d u logiciel
SEQAIDII accepte des données au format de GenBank ; celles qui proviennent
de E M B L ou de N B R F - P I R doivent donc être mises au format du logiciel (il
existe des outils spécifiques qui réalisent ces conversions de format, mais on
peut aisément le faire avec un éditeur de texte). Chaque séquence doit être
contenue dans un fichier particulier. Chaque fichier (ou enregistrement)
comporte nécessairement le nom de la séquence en première ligne et tous les
résidus en lettres capitales dans les lignes suivantes.
La séquence proprement dite peut être précédée d'un nombre variable de
lignes de commentaires qui sont affichées par certaines fonctions du logiciel
mais ignorées dans les fonctions de traitement. Le menu principal du logiciel se
présente de la manière suivante (fig. 2) :
S e q A i d
No
1
2
3
4
I I {tm)
Fichier
3.81
Date: 12-09-1992
Heure:12:50:222
Fl = A I D E
MENU
ENTREE DONNEES
L e c t u r e / E c r i t u r e sur d i s q u e
E d i t e r , créer des séquences
R e t i r e r une s é q u e n c e de la m é m o i r e
AUTRES
Fragments d'ADN
GenBank : accès
Changer
version
Répertoire: D:\SEQAID.SRC\
Mémoire libre: 402656 résidus
PRINCIPAL
FONCTIONS
: t a i l l e et m o b i l i t é
à la b a s e de d o n n é e s
SEQAID.CNF
ou
.COD
ANALYSE DE SEQUENCE
Alignement avec discontinuités
Bases utilisées : nature, fréquence
V i s u a l i s a t i o n de s i m i l i t u d e
Détection d'exons probables
P r é d i c t i o n s de s t r u c t u r e p r o t é i q u e
S i t e s p a r t i c u l i e r s d a n s l'ADN
Traduction
ENVIRONNEMENT SEQAID
Modifier (Bip/Silence)
Quitter
pour
DOS
Choix :
Fig. 2.- Ecran principal du logiciel SEQAIDII. La zone du haut de l'écran
recevra les séquences qui seront chargées en mémoire. Celle du bas est
réservée à l'affichage des menus et de certains dialogues.
Le logiciel est conçu comme une succession de menus et de sous-menus. Il
est possible de modifier la configuration de l'installation du logiciel qui
fonctionne, par défaut, avec un ensemble de fichiers fournis par les
concepteurs (code génétique, données sur les acides aminés, liste d'enzymes de
restriction, etc.). Les fonctions disponibles peuvent être regroupées en quatre
ensembles qui organisent l'accès aux informations, en permettent l'édition, la
comparaison et l'analyse.
1. Lecture, écriture, visualisation de séquences
a. Recherche de séquences dans un fichier issu de GenBank, en utilisant des
utilitaires similaires à ceux que nous avons mentionnés à propos du CDROM du
EMBL (numéro de la séquence, auteur, journal, organisme, etc.).
b. Accès à des séquences archivées sur un disque, lecture et écriture dans
n'importe quel répertoire existant (le logiciel est ainsi totalement ouvert sur
l'environnement) ; affichage à l'écran ou impression du contenu d'une
séquence, chargement en mémoire des séquences pour un volume total qui est
fonction de la taille mémoire disponible (fig. 3).
S e q A i d
No
2
3
4
5
6
Fichier
HBBADNC.ADN
HBBARNM.ARN
HBBCOD.ADN
HBB$HUMA.PRO
HBB'THAl.ADN
Taille
626
669
441
146
441
Type
nue
nue
nue
p tn
nue
I I
(tm)
Edité
version
R é p e r t o i r e : D : \ S E Q A I D .SRC\
M é m o i r e l i b r e : 3 4 3 1 0 9 rés idus
Date: 12-09 -1992
H e u r e : 1 7 : 2 7 :017
Fl = A I D E
ENTREE/SORTIE
Répertoire:
3.81
DISQUE
D:\SEQAID.SRC\
FICHIER
REPERTOIRE
Charger
Sauvegarder
Renommer
E f f a c e r (sur
Accéder
Modi f i e r
disque)
QUITTER
Choix
:
Fig. 3.- La nature de la séquence (nucléique ou protéique) est précisée par
l'utilisateur (sans contrôle du logiciel). Le numéro, le nom et la longueur de la
séquence sont affichés automatiquement. Les flèches vers le haut et vers le bas
indiquent la présence de séquences dans les parties cachées de la fenêtre.
c. Manipulation des séquences : charger, sauvegarder, effacer, renommer,
modifier le chemin d'accès à un répertoire, visualiser les séquences sur écran
ou sur imprimante (le logiciel gère quelques paramètres de l'impression : taille
et densité des caractères, longueur des lignes, etc).
d. Modification de la configuration d'installation du logiciel et définition
temporaire d'un code génétique non standard.
2. Edition et conversion de séquences
Cet ensemble de fonctions permet à l'utilisateur d'enrichir la banque de
données accessibles directement par le logiciel (fig. 4).
MENU DE L'EDITEUR
DE
SEQUENCE
Aligner, comparer
modifier deux séquences en mémoire
Convertir, copier, transcrire une séquence
Modifier des séquences
Saisir une séquence au clavier
Nommer une séquence en mémoire
Imprimer, afficher, sauvegarder une séquence
Retirer une séquence de la mémoire
Option Majuscules/Minuscules
Quitter
Choix :
Fig. 4.- Menu EDITE du logiciel
a. Entrée d'une séquence au clavier
Le programme propose deux modalités d'entrées : l'une est limitée à 70
résidus avec nécessité d'une confirmation (donc double entrée des données) ; la
seconde, plus simple permet d'entrer jusqu'à 1000 résidus à la fois.
L'utilisateur précise la nature de la séquence qu'il souhaite créer ; en fonction
de ce choix le programme utilise des filtres pour contrôler les caractères
frappés et éviter les erreurs (fig. 5).
MODIFICATION DES TABLES DE TRADUCTION DE
SEQAID
1 let. 3 let. AA#
AA#
1 let. 3 let.
AA#
A
1
Ala
11
M
Met
21
2
C
Cys
12
N
Asn
22
3
D
Asp
13
P
Pro
23
4
E
Glu
14
Gin
24
Q
5
F
Phe
15
R
Arg
25
6
G
Gly
16
S
Ser
26
7
H
His
17
T
Thr
27
I
V
8
Ile
18
Val
28
9
K
Lys
W
19
Trp
29
10
L
Leu
20
Y
Tyr
30
modif. trad. Codons., Acides aminés, valeurs
Fig. 5.- Correspondance
entre les codes 1 lettre et 3 lettres pour
protéines. Le logiciel accepte majuscules et minuscules.
les
b. Fabrication d'une séquence à partir d'autres séquences archivées
Extraction d'une portion de séquence, concaténation de deux morceaux,
troncature d'une séquence, altérations (modifications) ponctuelles.
c. Visualisation d'un enregistrement
A chaque séquence peut être associé un commentaire qui peut reprendre
certaines descriptions de la base de données originelle, préciser des
caractéristiques particulières de la séquence fabriquée.
d. Changement de casse (majuscules - minuscules)
Le logiciel n'accepte que les séquences figurant en lettres capitales. Cette
fonction permet de changer la casse pour tout ou partie d'une séquence ; on
peut ainsi préparer des séquences pour des éditions (fabrication de documents
par l'enseignant, par exemple) qui respecteraient des conventions d'écriture,
par exemple : les majuscules désignent les résidus certains, les minuscules les
résidus incertains ; ou bien les majuscules correspondent à des exons, les
minuscules à des introns, etc.
e. Conversion de séquences
S e q A i d
No
1
2
3
4
5
Fichier
HBB$HUMA.PRO
HBBETA.ADN
HBBCOD.ADN
HBBADNC.ADN
HBBARNM.ARN
Taille
146
1638
441
626
669
Type
ptn
nue
nue
nue
nue
II
Edité
(tm)
version
3.81
Répertoj re: D:\SEQAID.SRC\
Mémoire libre: 350224 résidus
Date: 12-14-1992
Heure:13:18:211
Fl = AIDE
TRADUCTION DE SEQUENCE ET CADRE DE LECTURE
Traduire une séquence d'ADN ou d'ARN
Rechercher les cadres de lecture
Inverser la traduction (protéine vers ADN)
Quitter
Traduction de
1 jusqu'à
667
DICF<HNCVH<QPQTDTMVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLWYPWTQRFFESFGDLSTPD
70
AVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEF
140
TPPVQAAYQKVVAGVANALAHKYH<ARFLAVQFLLKVPLFPKSNY<TGGYYEGP<ASGFCLIKNIYFHCK
210
KKKKKKKKKKKKK
22 3
...Cadre de lecture encore ouvert en fin de séquence...
Continuer jusqu'au prochain codon stop ou Menu suivant
Acide nucléique aligné avec la protéine correspondante
Séquence protéique
Table de fréquence des codons
Composition en acides aminés
Quitter
Fig. 6.- Fonctions présentées par les 2 menus successifs de traduction.
- Passage de l'ADN à l'ARN (T est remplacé par U) ou inversement.
Attention : cette conversion n'est pas véritablement une transcription ; elle
en fournit le résultat sans passer par son mécanisme réel (à partir du brin
complémentaire) puisque les séquences d ' A D N données sont constituées d'un
seul brin, celui qui n'est pas transcrit.
- "Traduction" d'un A D N ou d'un ARN en polypeptide (accessible à partir
du menu principal). Le point de départ de la traduction est précisé par
l'utilisateur. Le programme s'arrête au premier codon d'arrêt rencontré mais
propose de continuer fictivement la traduction (jusqu'au prochain codon
d'arrêt). On peut visualiser la protéine seule ou alignée avec la séquence
nucléique, examiner les différents codons utilisés dans la séquence nucléique ou
la composition de la protéine en acides aminés, etc. Les séquences résultant des
traductions peuvent être conservées en mémoire puis sauvegardées sur disque.
- "Traduction reverse" : en remontant de la protéine vers les différents
codons possibles (étant donné le caractère dégénéré du code génétique) pour
chaque acide aminé.
- Recherche de cadres de lecture : cette fonction traduit une séquence
nucléique en partant de la 1ère, 2ème et 3ème base. Deux modalités d'obtention
et d'affichage des résultats sont prévues :
• Présentation graphique : la traduction de la séquence est réalisée
automatiquement pour les trois cadres de lecture
qui sont affichés
simultanément. La présence du codon initiateur et des codons d'arrêt est mise
en évidence par les caractères " " et " v " respectivement. Les différents
acides aminés sont symbolisés par un tiret " - ".
A
. Présentation sous la forme d'un tableau : le logiciel demande
quelle dimension minimum, encadrée par un codon initiateur et un codon
d'arrêt, il faut rechercher. En fonction des ces indications (qui peuvent être
formulées connaissant la longueur de la protéine codée par la séquence), un
tableau est affiché qui précise pour chaque portion trouvée la position du
triplet d'initiation, du codon d'arrêt, ainsi que la longueur de la séquence
traduite en acides aminés.
3. La comparaison (alignement) de séquences
Trois types d'alignement sont prévus :
a. La recherche d'une similitude globale entre deux séquences. Celles-ci
sont comparées par "groupes" de bases ou d'acides aminés (plus la taille du
groupe est grande, plus la comparaison montrera les similitudes sur des
segments longs).
Chaque identité résultant de cette comparaison est symbolisée par un point
(on parle d'une matrice de points). On construit ensuite un graphique avec
l'une des séquences en x et l'autre en y. Les portions identiques montreront un
alignement régulier de points sur la diagonale (fig. 7).
HOMOLOGY GRAPHICS
Date: 12-10-1992
Time: 17:37:34
1 to 1626 for HBBETA.ADN
on horizontal axis
1 to 650 for HBRADNC.ADN on vertical axis
Each character represents 25 bases.
19 Matches reported as dots
012345678901234567890123456789012345678901234567890123456789012345
1
1
2
2
3
3
4
4
5
5
6
6
7
7
8
8
9
9
0
226
1
1
2
2
3
3
4
4
5
5
6
6
7
7
8
8
9
9
0
476
1
1
2
2
3
3
4
4
5
5
012345678901234567890123456789012345678901234567890123456789012345
System Time: 17:37:37
Fig. 7.- Matrice des similitudes entre deux séquences.
L'analyse de ce graphique permet de localiser les segments, similaires ou
différents, à analyser de manière plus détaillée avec d'autres fonctions. Par
exemple, les trois alignements de points représentent les exons de ce gène.
b. L'alignement sans recherche de discontinuités
Cette fonction est adaptée pour des séquences très proches et sans
discontinuités et met en évidence des différences ponctuelles. Elle propose soit
un alignement automatique,.à partir de positions de départ calculées par le
logiciel, soit une définition par l'utilisateur des positions à partir desquelles il
faut aligner les deux séquences (fig. 8). A l'affichage, les résidus différents
sont matérialisés par un code couleur ; les deux séquences peuvent ensuite être
modifiées ou décalées l'une par rapport à l'autre ; on peut aussi les parcourir
dans les deux sens.
c. L'alignement avec recherche de discontinuités : l'utilisateur spécifie
pour chaque séquence, les positions à partir desquelles le programme doit
chercher à aligner, ainsi que le nombre minimum de résidus identiques
consécutifs à prendre en considération.
Le logiciel recherche les différents alignements possibles (qui traduisent plus
ou moins bien la similitude entre les deux séquences) et affiche un score de
similitude.
Comparaison de HHBADNC.ADN
1 jusqu'à
626
I jusqu'à
1638
avec HBBETA.ADN
Alignement par groupes de :6
Numéro d'alignement :1
Nombre d alignements :620 Nombre de discontinuités : 2
Heure de début:13:14:22 Heure de fin:13:14:26
v
v
v
v
v
v
v
v
HHBADNC.ADN
48
HBBETA.ADN
80
ACATITCKTITCTTCL^CACM
CATAAAAGTCAGGGCAGAGCX]^^
v
v
-
v
v
v
v
v
v
HHBADNC.ADN
128
HBBETA.ADN
160
v
HHBADNC.ADN
140
HBBETA.ADN
240
v
HHBADNC.ADN
158
HBBETA.ADN
320
ccAranrx^crac^c^^
v
v
v
v
v
v
v
GAGGCCCTGGGC
GAGCXXXHTXXXWÎGTTGK^^
v
v
v
v
v
v
v
AGGCIXXnX3CnX3GTCTAC
AGACIXTTTGXXjTITCTC
v
v
v
v
v
v
v
v
HBBADNC.ADN
238
HBBETA.ADN
400
(XTRXWX)CAGAG(ÏÏTCT
OTTGŒAœCAGAGCTTOT
Fig. 8.- Alignement d'un gène et d'un ADNc mettant en évidence promoteur,
exon et intron. Le logiciel ne peut aligner que deux séquences dont la longueur
totale ne dépasse pas 14 000 bases.
d. On peut rapprocher de ces comparaisons une fonction qui calcule la
probabilité pour qu'un nombre de résidus similaires dans deux séquences soit
dû au hasard. L'utilisateur doit spécifier la longueur d'une des séquences ainsi
que le nombre de résidus identiques trouvés. Pour une séquence nucléique, de
calcul se fait sur la base d'une probabilité de 25% pour q'une base azotée soit
présente du seul fait d'une répartition aléatoire. Il faut donc que la proportion
de bases identiques soit nettement supérieure à ce taux pour qu'une explication
de cette ressemblance par un facteur que le hasard soit acceptable.
4. Analyse de séquences
On peut regrouper dans cet ensemble les fonctions suivantes :
- composition d'une séquence nucléique (décompte des codons utilisés) ou
protéique (acides aminés utilisés et calcul de la masse molaire de la protéine),
- établissement d'une carte de restriction d'une séquence ; une liste de 114
enzymes de restriction est proposée par le logiciel, liste qui peut être enrichie
par l'utilisateur ; de manière plus générale, cette fonction permet de
rechercher une suite quelconque de résidus (donc des motifs particuliers),
- localisation, dans une séquence anonyme, de parties (probablement)
codantes, en utilisant les fréquences des codons utilisés dans des séquences
codantes connues,
- prédiction de l'hydrophobicité d'une protéine (fig. 9), et de son
antigénicité, le calcul de la probabilité pour que des parties aient une structure
secondaire du type hélice alpha ou feuillet bêta, etc.
Hydrophilic
residue
1 V
2 H
3 L
4 T
5 P
6 E
7 B
8 K
9 S
10 A
11 V
12 T
13 A
Score
4.20
-3.20
3.80
-0.70
-1.60
-3.50
-3.50
-3.90
-0.80
1.80
4.20
-0.70
1.80
Avg.
-0.643
-1.800
-1.457
-1.743
-1.043
-0.914
-0.157
0.886
1.314
1.371
0.557
0.557
0.157
0 Hydrophobic
*
*
t
t
t
t,
, t
,t
, t
t
Fig. 9.- Affichage de l'hydrophobicité calculée d'une protéine
(fragment).
Sur une échelle allant de -4,5 à +4,5, l'hydrophobicité est calculée pour chaque
acide aminé et les n acides aminés suivants.
B. B a n q u e de données associée à S E Q A I D I I
1. Constitution de la banque
Le nombre de séquences disponibles étant considérable, une sélection
s'impose. Pour constituer une banque de données adaptée à l'enseignement nous
avons pris en considération plusieurs facteurs :
- Les connaissances actuellement exigibles dans différentes sections au lycée,
et dans une certaine mesure, dans les classes préparatoires aux Grandes Ecoles
et le premier cycle universitaire ; les thèmes d'enseignement qui sont présentés
ci-dessous illustrent l'adéquation que nous avons recherchée.
- Les gènes pour lesquels on dispose de données qui permettent de les utiliser
dans l'étude de différents thèmes, même si certains d'entre eux sont plus
particulièrement indiqués pour un thème spécifique.
- Les gènes étudiés classiquement en hérédité humaine afin de favoriser le
lien entre génétique moléculaire et génétique formelle.
- Les fonctions offertes par le logiciel S E Q A I D I I , en nous attachant
particulièrement aux opérations qui sont compréhensibles et réalisables par les
élèves eux mêmes. Nous avons ainsi tenté de rechercher les situations qui se
prêtent à des activités individuelles de recherche et de traitement, ainsi qu'à des
phases collectives d'interprétation, d'explication et de synthèse.
Nous avons également voulu introduire dans la banque un nombre suffisant
de gènes, pour que l'enseignant puisse, à différents moments de l'année, opérer
un choix et utiliser les données adaptées à tel ou tel chapitre du programme
qu'il est en train de traiter
En consultant les bases de données disponibles, on constate une grande
diversité dans le contenu des items, reflet de la diversité des publications de
référence : gènes entiers, pseudogènes, parties codantes, exons ou introns
complets, fragments divers, allèles, etc.
La constitution de la banque pour l'enseignement a donc bénéficié de
nombreuses séquences extraites des bases internationales et, pour une large
part, des publications scientifiques originales concernant ces séquences. En se
référant à ces publications, un très grand nombre de séquences a été reconstruit
avec les fonctions d'édition du logiciel SEQAIDII. La confrontation systématique
des séquences issues des bases de données avec les publications a permis
d'effectuer le contrôle indispensable des séquences.
De la même manière, on a contrôlé les transcriptions, traductions,
alignements réalisés par le logiciel en les comparant aux informations et aux
séquences présentes dans les bases de données et dans les publications
scientifiques.
2. Contenu de la banque
Quelques conventions simples ont été retenues pour la dénomination des
séquences (8 lettres maximum) afin d'indiquer l'organisme, le type de séquence
(gène entier, exons, etc.), ainsi que sa nature nucléique ou protéique.
Pour la plupart des gènes, ont été constitués des fichiers correspondant aux
séquences suivantes :
- le gène complet (x.ADN, où x désigne en abrégé le nom du gène) s'il est
disponible et si sa longueur n'est pas trop grande ; dans certains cas, seuls les
exons ont pu être retenus,
- la séquence de l'ARN messager (xARNmARN),
- la séquence d'ADN correspondant à l'ARN messager dépourvu de sa coiffe
et du poly A (xADNc.ADN),
- La séquence du gène strictement codante (xCOD.ADN) correspondant à la
protéine strictement traduite (donc avec ATG en tête).
- la protéine réelle (x.PRO, x incluant en abrégé le nom de la protéine et son
caractère ribosomial, membranaire ou sécrétée),
- différents allèles du gène, s'il en existe.
«A : \ »
«F : \ »
«K : \ »
«P: \ »
«U: \ »
«Z : \ »
BETATHA
MBBARNM
HBB'DRE
HBB'THA
3 . ADN
. ARN
P. A D N
5 .ADN
D a t a P a t h : D : \BIOMOL\SF,QA J D 3 8 \
Directory : D : \BIOMOL\SEQCOM\(iLOBINES\BETA\
«B : \ »
«C: \»
«D: \ »
«E: \ »
«G: \ »
«H : \ »
«J : \ »
«J : \ »
«L : \ »
«M: \ »
«N: \»
«O : \ »
«Q:\»
«R : \ »
«T:\»
«S : \ »
«V : \ »
«W : \ »
«Y : \ »
«X : \ »
«PREV DIR»
B E T A T H A 1 . ADN
HBBETA'.ADN
BETATHA2.ADN
BETATHA4.ADN
HBB$HUMA. PRO
BETATHA5.ADN
HBBCOD.ADN
HBBADNC.ADN
H B B ' T H A Ï . ADN
HBB'HEMC.ADN
HBBETA.ADN
HBB'THA8.ADN
H B B ' T H 3.ADN
HBB'THA2.ADN
HBB'THAI.ADN
HBB'THAG.ADN
HBB'THA7.ADN
Fig. 10.- Diverses
séquences
correspondant
allèles.présentes dans la banque de données.
au gène
bêta
et
ses
Le gène, l'ARNm et la protéine constituent des objets biologiques réels. Le
transcrit primaire qui appartient aussi à cette catégorie est peut-être une des
adjonctions à réaliser.
Les informations suivantes ont déjà été incorporées dans la banque :
a. les gènes qui codent pour les différentes chaînes de l'hémoglobine
- gène alpha, qui s'exprime dans la période foetale et ultérieurement chez
l'individu adulte,
- gène bêta et delta qui s'expriment durant la vie adulte (avec une
proportion très réduite de la chaîne delta par rapport à la chaîne bêta ; les
allèles du gène codant pour l'hémoglobine bêta constituent un modèle pour les
différentes mutations qui peuvent affecter le gène.
- gène gamma, qui s'exprime exclusivement pendant la période foetale.
Les gènes codant pour ces globines forment une famille multigénique.
b. Le gène qui code pour une enzyme qui intervient dans la dernière étape de
la synthèse des antigènes du groupe sanguin ABO. Seule est retenue la partie
codante. Les trois allèles de ce gène constituent un exemple pour montrer des
variations génétiques non pathologiques.
c. Les gènes qui codent pour le système HLA : l'extrême polymorphisme de
ces gène est remarquable avec de nombreux allèles tous fonctionnels ; leurs
allèles présentent de nombreuses parties communes ainsi que beaucoup de
substitutions et de délétions, et constituent un autre exemple de famille
multigénique.
d. le gène qui code pour le récepteur aux lipoprotéines a de nombreux allèles
dont certains présentent des délétions importantes. Selon l'endroit affecté par la
mutation, il peut y avoir soit absence d'internalisation du complexe récepteurL D L , soit un déficit dans la liaison aux L D L , soit une absence totale du
récepteur. Il en résulte, dans tous les cas, un niveau élevé de cholestérol dans le
sang.
Ce gène étant très grand, on n'a retenu que les exons interrompus par des
" N (n'importe quelle base) pour représenter les introns. Ces exons
permettent d'étudier les possibilités de genèse d'un gène au cours de l'évolution
par amplification d'un exon et par association d'exons appartenant à d'autres
gènes.
11
e. Le gène qui code pour une enzyme impliquée dans la conversion de la
phénylalanine en tyrosine, dont le déficit est responsable de la phénylcétonurie.
Seule est disponible l'ADNc de ce gène très grand. L'intérêt de ce gène est de
montrer un exemple où le phénotype clinique est dû à une interaction entre le
gène et le milieu : il suffit de ne pas ingérer de phénylalanine pour que le sujet
ne présente plus les symptômes cliniques de la maladie.
f. Les gènes de la prolactine, de l'hormone de croissance, de l'hormone
lactogène placentaire, d'une part, et ceux de la chaîne bêta des hormones FSH,
TSH et LH d'autre part, forment deux familles multigéniques qui permettent
d'illustrer la notion de "bricolage moléculaire" au cours de la complexification
du génome.
C. Les thèmes d'utilisation du logiciel et des données
Etant donné le caractère particulièrement ouvert du logiciel, il est illusoire
de définir une progression pédagogique pour son utilisation qui peut concerner
l'un ou l'autre des sujets d'étude possibles, et intervenir avec différents niveaux
de prérequis des élèves. Nous nous en tenons aux sujets qui concernent
l'enseignement au lycée, sachant que d'autres sont abordables dans les classes
préparatoires aux grandes écoles et dans les cycles universitaires, avec
probablement un jeu de données élargi. Les thèmes d'étude peuvent concerner :
- le code génétique : caractéristiques, cadre de lecture,
- les structures de l'ARN messager et du gène chez les eucaryotes
- les allèles du gène,
- les familles multigéniques et la complexification du génome.
Certains de ces thèmes résultent, en partie, des potentialités théoriques
ouvertes par les fonctions du logiciel. D'autres sont issues des utilisations
pratiques observées dans les classes au cours de l'année scolaire 1991-1992.
Nous en donnons plus bas quelques exemples II n'en reste pas moins que tous
les sujets n'ont pas encore été éprouvés et ne peuvent conduire à formuler des
résultats détaillés.
Les gènes présents dans la banque de données sont adaptés à des degrés
divers pour au traitement de ces thèmes. Ainsi, tous les gènes se prêtent à la
mise en évidence de la relation ADN - protéine, mais on dispose :
- du gène complet, de l'ARNm et de la protéine seulement pour les globines,
le gène HLA et le récepteur au LDL,
- d'allèles des gènes codant pour la chaîne bêta de l'hémoglobine, les
antigènes du système HLA, ceux du groupe A B O , les récepteurs aux LDL, et
l'enzyme assurant la conversion de la phénylalanine en thyrosine.
- de familles multigéniques avec les globines et les deux familles d'hormones
(FSH, TSH, LH) et (GH, prolactine et hormone lactogène placentaire).
1. Code génétique : caractéristiques, cadre de lecture
Dans un premier temps, une réflexion théorique sur la correspondance entre
l ' A D N et un polypeptide, permet de dégager les solutions possibles et les
problèmes à résoudre. Ainsi, l'élève dispose d'un guide ouvert pour conduire
sa recherche en situation d'autonomie.
Deux possibilités sont offertes :
- Rechercher les caractéristiques du code génétique à partir de molécules
d ' A D N artificielles élaborées au clavier. C'est en somme la situation des
généticiens au début des années soixante quand ils ont déterminé le code
génétique à partir de la traduction in vitro d'ARNm de synthèse.
Le logiciel ne permet pas d'entrer directement au clavier des séquences
d'ARN. On peut se contenter d'entrer des séquences d'ADN et établir le code en
termes de codons d'ADN.
Si on désire déterminer le code génétique en termes d'ARN, il faut convertir
l'ADN en A R N avec la fonction correspondante du logiciel. Répétons que cette
conversion n'est pas une transcription car elle se borne à remplacer les
thymines par des uraciles.
Pour établir le code complet, une stratégie, répartissant le travail entre les
élèves ou suggérant une manière de résoudre économiquement le problème, est
à définir. Plusieurs possibilités de variation sont possibles qui portent sur :
- la nature des bases de la séquence éditée (nucléotides tous identiques,
deux nucléotides différents se répétant, etc.),
- la longueur de la séquence (multiple de 3 ou non),
- le cadre de lecture (à partir de la 1ère, 2ème ou 3ème base) de cette
séquence.
Les caractéristiques du code génétique seront dégagées à partir des
informations recueillies par les différents groupes : notion des triplets non
chevauchants, redondance, importance des cadres de lecture, codons de
terminaison. Cette activité utilise uniquement les fonctions d'édition (saisie de
séquences au clavier) et de traduction.
- Rechercher les caractéristiques du code génétique à partir des séquences
d'ARNm et de polypeptides correspondantes en procédant à des traductions. En
particulier, l'option "traduction reverse" d'une protéine donnera toutes les
possibilités de codons pour un acide aminé. En conséquence, le tableau du code
génétique et son caractère dégénéré pourront être en grande partie retrouvés.
On peut partir, par exemple, d'une des chaîne de l'hémoglobine.
Reverse Translation of HBB$HUMA. PRO
Nucleic Acid bases are ACGT N=Any base R=Purine Y=Pyrimidine
Val His Leu Thr Pro Glu Glu Lys Ser Ala Val Thr Ala Leu Trp Gly
GTN CAY TTR ACN CCN GAR GAR AAR TCN GCN GTN ACN GCN TTR TGG GGN
CTN
AGY
CTN
16
Lys Val Asn Val Asp Glu Val Gly Gly Glu Ala Leu Gly Arg Leu Leu
AAR GTN AAY GTN GAY GAR GTN GGN GGN GAR GCN TTR GGN OGN TTR TTR
CTN
AGR CTN CTN
32
Val Val Tyr Pro Trp Thr Gin Arg Phe Phe Glu Ser Phe Gly Asp Leu
GTN GTN TAY CCN TGG ACN CAR OGN TTY TTY GAR TCN TTY GGN GAY TTR
AGR
AGY
CTN
48
Fig. 11.- 'Traduction reverse" de la chaîne bêta de
l'hémoglobine.
Il ressort de la mise en oeuvre dans les classes que les élèves (des classes
littéraires, notamment) apprécient ces types d'activités.
Il convient cependant de leur faire observer que le logiciel propose des
fonctions de traitement formelles qui appliquent mécaniquement les
connaissances en biologie moléculaire mais qui n'ont rien de biologique C'est
ainsi par exemple que la traduction d'une séquence d'acides nucléiques peut
aboutir à des codons de terminaison : le logiciel arrête la traduction à ce
moment là, mais il la poursuit si l'utilisateur le demande. De même, il faut bien
faire remarquer aux élèves que la "traduction reverse" n'existe pas dans la
nature. Il existe une difficulté méthodologique difficile à aborder à ce moment
du travail mais qui peut être dégagée ultérieurement : la fonction de traduction
ne nécessite pas de séquence promotrice ou de codon initiateur.
2. L'ARN messager
L'information génétique est contenue dans le noyau alors que les protéines
sont fabriquées dans le cytoplasme. Il y a donc nécessité d'un intermédiaire
"messager" apportant l'information nécessaire à la synthèse protéique.
Pour montrer la relation entre l'ARNm et la protéine fabriquée, l'élève
charge en mémoire, pour un gène donné, l'ARNm choisi dans la banque et la
protéine correspondante. Il constate, par l'affichage automatique de la
longueur des deux séquences que l'ARN est plus long que nécessaire pour la
synthèse de la protéine {n nucléotides > 3n' acides aminés).
Le problème se pose de savoir quelle partie de l'ARNm est traduite et selon
quel cadre de lecture. L'élève peut donc demander la traduction de l ' A R N m
(fonction Translate du logiciel). En commençant la traduction successivement
à la première, deuxième et troisième base, il se rendra compte, en fonction des
codons d'arrêt rencontrés, qu'un seul cadre de lecture convient compte tenu de
la longueur de la protéine. Le résultat de la traduction (incluant la protéine
probable) sera sauvegardé et comparé à la protéine réelle, par la fonction
d'alignement, ce qui permettra de bien délimiter la partie traduite. On
localisera ainsi le début et la fin de la partie codante de l'ARNm (hormis le
codon A U G qui se trouve devant, puisque la méthionine n'existe plus dans la
protéine réelle).
Comparaison de PR01
1 jusqu'à
223
avec HBB$HUMA.PRO
1 gusqu'a
146
Alignement par groupes de :2
Numéro d'alignement :1
Nombre d'alignements :146 Nombre de discontinuités :0
Heure de début:13:24:15 Heure de fin:13:24:16
V
V
V
v
V
V
PROl
V
70
DICF<HNCVTKQPQT[T)TMW^
VffliTPÈÈ&ÂVTÀ^^
HBB$HUMA.PRO 52
v
v
v
v
v
v
PROl
v
140
AVMGNPKVKAHG3QCVLGAFSDGL^^
ÀVMGNMVT^^
v
v
v
v
v
HBB$HUMA.PRO 122
v
v
PROl
210
TPP^QAAYQKWAGVANALAHKYH<ARF^
TPPVQAAYQKWAGVANALAHKYH
HBB$HUMA.PRO 146
V
V
V
V
^_„_^ ,„^„^,^,^,
KKKKKKKKKKKKK
T
r
rr
r
V
V
PROl
r
v
223
HBB$HUMA.PRO 146
Nombre total d'appariements:
Fig. 12.- Alignement de la protéine
l'ARNm avec la protéine réelle.
146
résultant
de la traduction
de tout
Il est possible d'arriver aux mêmes conclusions de différentes autres
manières. Par exemple, l'élève peut utiliser la fonction du logiciel qui traduit
automatiquement un A R N m dans les trois cadres de lecture et affiche
simultanément les trois résultats.
On peut aisément repérer visuellement celui qui détermine une portion dont
la longueur entre un codon initiateur et un codon d'arrêt est identique à celle
de la protéine. En amont et en aval de cette portion on peut trouver des codons
stop. On constate également que tout l'ARNm n'est sans doute pas traduit (fig.
13).
SEQAIDII- Open Reading Frames in HBBARNM.ARN
" f o r start, v for terminator, - openframe
Reading frame:
1
*
v
System Time : 17:53:41
*
*
*
*
*
*
~
v
210
420
630
—~
v
v
v
*
*
666
Reading frame : 2
*
*
*
*
v
--~
*
v--~
v
v
~
~
667
~
v
~
211
421
631
v-
212
422
632
w
Reading frame : 3
*
*
*
*
*
v
v
w
v
v
*
v
v
v
v
*
v
v
v
668
System Time:17:53:42
Fig. 13.- Traduction de l'ARNm dans les trois cadres de lecture. Le premier
fournit le seul segment ayant la longueur de la protéine réelle.
Cette même fonction permet d'aller encore plus vite : il est possible de
demander si la traduction de l'ARNm dans les différents cadres de lecture
donne un segment dont la longueur est égale à celle de la protéine. Le
Programme affiche le cadre adéquat et les positions correspondant au début et
à la fin de la traduction.
3. Activités autour du gène eucaryote
Dans les cellules, le gène est transcrit en ARNm avant d'être traduit. La
comparaison du gène entier avec l'ARNm (transformé en ADN pour la nécessité
de l'alignement) montre les parties transcrites (exons) et non traduites (introns
et promoteur). La notion de gène morcelé est ainsi mise en évidence.
De plus, l'élève constate qu'il existe au niveau de l'ARNm des parties absentes
dans le gène : les poly A à la fin et la guanine au début (Méthylée et
triphosphatée). Ainsi, à travers des exemples différents pris dans la classe, des
schémas généraux de structures de l'ARNm et du gène seront réalisés.
Pour le détail, il sera possible de constater que :
- le nombre d'exons et d'introns peut être variable suivant les gènes
considérés (aux limites entre exons et introns on trouve des GT et AG),
- vers la fin du gène existe toujours une séquence AATAAA (signal de fin
de transcription reconnu par l'ARN polymèrase),
- au début du gène existe toujours des séquences CATAAA et TATAAA
reconnues par l'ARN polymèrase.
La notion de gène peut être abordée selon plusieurs niveaux de complexité :
le gène entier en terminale, le gène "ADNc" (correspondant en ADN à l'ARNm
sans G devant et sans poly A à la fin) en classe de première scientifique, le
gène "x.CODADN" (correspondant à la partie strictement codante) en classe de
première littéraire. En utilisant les parties strictement codantes (appelées
x.CODADN) les élèves constateront, par alignement avec le gène entier, que le
codon de début de traduction est toujours ATG (AUG en ARNm) et qu'un codon
STOP fait suite au dernier codon de x.CODADN.
4. Allèles du gène, mutations et conséquences
Certains allèles peuvent être responsables de maladies ; aussi la comparaison
pour un gène de l'allèle "normal" et d'allèles "mutés" permet de bien situer les
différents types de mutations. La traduction des allèles mutés montrera les
conséquences de ces mutations au niveau de la protéine synthétisée.
a. Les mutations affectent la partie codante du gène
L'alignement de la partie codante du gène 8 normal de l'hémoglobine
(HBBCOD.ADN) avec la partie codante d'allèles mutés (HBB'X. ADN) montre
tous les types de mutations possibles : substitution d'une base par une autre
(drépanocytose, hémoglobinose C), insertion d'une base (HBB'THA5. ADN),
délétion d'une ou de plusieurs bases (HBBTHA6. ADN et H B B T H A 8 . ADN).
Par la traduction des allèles mutés et la comparaison des protéines obtenues
avec la protéine normale, les conséquences au niveau du phénotype moléculaire
de ces mutations apparaîtront : acide aminé remplacé par un autre (délétion ou
addition entraînant un changement de cadre de lecture), acides aminés changés
à partir de l'endroit muté (transformation d'un codon en codon STOP), chaîne
considérablement raccourcie.
b. Les mutations affectent n'importe quelle partie du gène
La même démarche que précédemment sera appliquée ici. Avec les
séquences BETATHAx.ADN les mutations sont localisées au niveau du
promoteur, des introns, des limites introns-exons faisant que l'anomalie est
moins grave que lorsqu'il y a changement de la partie codante. La séquence
HBBETA'ADN bien que présentant 4 mutations par rapport au gène "normal"
ne change rien dans la séquence protéique synthétisée. Tout est donc normal
dans l'expression de cet allèle. La notion de mutation neutre et de phénotype
moléculaire conservé sont ainsi abordés.
Dans l'exemple du gène du récepteur au LDL, certains allèles résultent
d'importantes délétions de nucléotides :
- l'allèle HYPCINT4.LDL empêchant l'internalisation membranaire et
cytoplasmique du récepteur, résulte d'une délétion de 5500 paires de base (de
l'intron 15 à l'exon 18),
- dans le cas de l'allèle HYPCABS3.LDL il y a suppression des 13ème et
14ème exons, la protéine ne possède plus que 629 acides aminés (un stop
apparaissant en 630) ; il y a absence du récepteur,
- l'absence des exons 2 et 3 pour l'allèle HYPFIX2.LDL entraîne un déficit
dans la liaison du LDL au récepteur.
5. Complexification du génome et familles multigéniques
Le génome est constitué d'un certain nombre de molécules d'ADN et chaque
molécule peut être "subdivisée" en segments de différents types :
- les gènes, unités d'expression conduisant à la fabrication de produits
fonctionnels (ARN ou polypeptides) ; certaines régions d'un gène sont codantes
pour le produit, d'autres, non codantes, peuvent être soit des régions
régulatrices, soit des séquences intercalaires (exemple : les introns),
- les pseudogènes, semblables à des gènes fonctionnels déterminés, mais ne
conduisant pas à des produits fonctionnels car ils sont le résultat de mutations
inactivatrices (présence de codons STOP, par exemple) ; les pseudogènes sont
souvent étroitement liés aux gènes fonctionnels correspondants.
- les régions non codantes.
Le génome des eucaryotes possède de très nombreux segments d'ADN répétés
précisément ou avec des variations. Gènes et pseudogènes en sont des exemples
et forment une famille de séquences répétées.
Certaines de ces familles correspondent à des alignements ininterrompus en
tandem, d'autres comportent des "unités" de répétition qui sont séparées par
d'autres séquences, et enfin il peut y avoir dispersion des répétitions sur des
chromosomes différents.
L'augmentation du nombre de copies d'un segment d ' A D N est appelée
amplification. Dans l'évolution du génome ce phénomène est primordial. La
probabilité pour que deux séquences soient apparues par copie d'un segment
d'ADN unique est d'autant plus élevée que leur similitude est grande.
Les banques de données permettent de mettre en évidence la notion de
création de nouveaux gènes par duplication d'un gène ancestral suivie d'une
diversification. Prenons l'exemple de la famille multigénique hormone de
croissance, prolactine, hormone lactogène placentaire. Le travail sur
ordinateur consiste essentiellement en des comparaisons de ces molécules.
a. Comparaison hormone de croissance - prolactine
Ces protéines ont une taille semblable, de 190 à 199 acides aminés suivant les
espèces ; elles diffèrent de 65 %, mais on retrouve des acides aminés communs
aux mêmes positions. La plupart des vertébrés ne possèdent qu'un gène de
prolactine et un gène d'hormone de croissance par génome haploïde ; chez
l'homme ces gènes sont placés respectivement sur les chromosomes 6 et 17.
Les deux gènes possèdent 4 introns situés quasiment aux mêmes sites mais dont
la taille est très différente entre les deux gènes.
b. Comparaison hormone de croissance - hormone lactogène placentaire
Cette dernière hormone n'est présente que chez les Mammifères placentaires.
La similitude entre les deux protéines est de 85 %, et pour les séquences
codantes des gènes elle est de 95 %.
Comparison of HGHSEC.PRO
1 to
191
with HHLPSBC.PRO
1 to
191
Aligned using Ktuple of :2
Alignment Number :1
Alignment score : 141
Gap score :2
StartTime:18:36:32 EndTime:18:36:32
V
V
V
V
V
V
V
HGHSEC.PRO
70
HHLPSEC.PRO
70
FPTIPLSRLFDNAMIJ^AHRIJIQIA
VQTVTLSRLFDHAML^^
V
V
V
V
V
V
V
HGHSEC.PRO
140
HHLPSEC.PRO
v
HGHSEC.PRO
140
v
191
HHLPSEC.PRO
191
SNnLELIJnSLLLIQSWLEPVQFLRSWANSL^
SNLELIJUSLLLIESWIJEPVI^
v
v
v
v
v
QTYSKFIJIWSHNDDALU^
QTYSKFDTNSHNHDALLKIW^
Total Number of Matches:
163
Fig. 14.- Alignement des deux protéines humaines sécrétées
croissance et hormone lactogène placentaire.
: hormone de
c Comparaison des exons de l'hormone de croissance
Cette hormone possède 5 exons. Le premier et le début du deuxième
correspondent à la séquence signal ; la fin du deuxième, le quatrième et le
cinquième présentent des similitudes, ce qui suggère une amplification en
tandem d'un gène ancestral. L'exon trois qui est différent aurait pour origine
un brassage d'exons ou serait le résultat d'une insertion d'un exon copié à
partir d'un autre gène : en effet, le peptide codé par cet exon ne stimule pas la
croissance mais a une activité anti-insulinique (l'hormone de croissance a les
deux activités).
En conclusion générale il ressort que :
- L'hormone de croissance et le prolactine étant présentes chez tous les
vertébrés, on peut supposer qu'un gène ancestral unique a été dupliqué avant
que ne divergent les poissons et les amphibiens (il y a plus de 400 millions
d'années). Les deux gènes ont évolué indépendamment chez chaque espèce et se
sont trouvés dispersés dans le génome.
- L'hormone lactogène placentaire est présente uniquement chez les
Mammifères placentaires. Le gène qui code pour cette hormone polypeptidique
résulte de la duplication du gène de l'hormone de croissance survenue il y a
plus de 85 à 100 millions d'années.avant la diversification des Mammifères
placentaires. Les deux gènes sont restés liés génétiquement au chromosome 17
et l'on constate que les primates possèdent ces deux gènes en plusieurs
exemplaires, traduisant un phénomène d'amplification supplémentaire ayant eu
lieu avant le développement des primates (il y a 60 millions d'années).
D. Les utilisations en classe
L'utilisation expérimentale du logiciel et des données a été réalisée en 19911992 dans une douzaine de classes de terminales D et C et en première A et B.
Suivant les lycées, diverses conditions matérielles ont été rencontrées :
utilisation par le seul enseignant devant la classe dans les établissements ne
disposant que d'un ordinateur, passage des élèves par rotation lorsque 3 ou 4
machines sont disponibles, travail des élèves par binômes dans certains
établissements équipés d'un nombre de machines suffisant pour un demi
groupe.
De même, diverses modalités d'intégration du logiciel ont été adoptées :
utilisation hors horaire normal d'enseignement, exploitation comme outil
d'évaluation (mise en pratique) d'un enseignement préalable, introduction des
nouvelles notions à acquérir à l'aide du logiciel et des données.
Les durées et formes d'organisation des séances exploitant l'ordinateur ont
été elles aussi diversifiées, allant de la séance unique de 3 heures explorant
différents thèmes, jusqu'à un fractionnement de l'utilisation en plusieurs
séquences courtes, échelonnées en fonction de la progression.
En général, les comptes-rendus de ces séances soulignent les apports du
logiciel tout en marquant quelques insuffisances.
- intérêt du logiciel :
- accès à des informations qui permettent de répondre à des
problèmes biologiques en émettant des hypothèses, en les testant et en
construisant des modèles (voir référentiels de seconde et de première),
- démarche inductive dans la mesure où, à partir d'informations
diverses (gènes, allèles, protéines, etc.) on élabore des représentations à
caractère général,
- caractère plus tangible des notions qui passent par des séquences
qui peuvent être comparées, traduites, converties, etc.
- limites du logiciel :
- impossibilité de saisir des séquences d'ARN au clavier et de
reproduire le mécanisme de la transcription,
- nécessité de fournir aux élèves un guide pratique pour
l'utilisation du logiciel,
- dans certains cas, difficulté de manipulation de la version
anglaise par les enseignants et les élèves.
1. Exemple d'utilisation en classe de première A
Cette démarche a été réalisée en 1991-1992 au Lycée Parc des loges à Evry.
L'objectif du travail est d'étudier comment l'information génétique
s'exprime à travers la synthèse des protéines, ce qui revient à poser les
problèmes suivants : caractéristiques du code génétique, caractère polarisé ou
non du message lu, nature des divers types de mutations et conséquences de
celles-ci.
A ce stade du cours, les élèves connaissent les protéines et l ' A D N ,
information génétique localisée dans les chromosomes. Le travail se fait sur le
gène bêta de l'hémoglobine et ses différents allèles (thalassémies,
drépanocytose, hémoglobinose C). Les séquences nucléotidiques données
correspondent à la partie strictement codante du brin d ' A D N non transcrit ;
cela représente le gène pour l'élève.
La démarche consiste à charger en mémoire deux séquences du gène (l'allèle
normal et un allèle muté) et les protéines correspondantes (résultant de la
traduction préalable de ces allèles). La fonction d'alignement permet aux élèves
de comparer les deux allèles, d'une part, et les deux protéines, d'autre part.
Les différences constatées sont notées précisément (position et nature du
changement) dans un tableau des résultats pour toute la classe (fig. 15).
ADN
PROTÉINE
position (P)
changement
position (A)
changement
DREP
200
A—>T
7e
E->V
HEMC
19e
G—>A
7e
E—>K
THA1
52B
A—>T
18e
THA2
118e
C->T
40e
THA3
47e
G—>A
16e
THA4
20B
manque A
7e
THA5
217e
T en plus
73e
THA6
51e
manque C
18e
THA7
289
N ? en plus
10e
THA8
124e— > 127e
manque TTCT
42e
chaîne de 17 AA
(normaux)
chaîne de 39 AA
(normaux)
chaîne de 15 AA
(normaux)
chaîne de 18 AA
(* à partir du 7e)
chaîne de 72 AA
(normaux)
chaîne de 18 AA
(dernier différent)
chaîne de 22 AA
(* à partir du 10e)
chaîne de 59 AA
* à partir du 42
e
Fig. 15.- Tableau synthétique indiquant les différences entre le gène bêta
normal et plusieurs de ses allèles, ainsi que les différences entre les protéines.
DREP : Drépanocytose ; HEMC : Hémoglobine C; THA : Thalassémie ;
N : Base
indéterminée.
L'exploitation de ces comparaisons sur la position des changements permet
de poser le problème de la représentation des résultats. La figure 16, par
exemple, montre bien la correspondance ordonnée de la position (A) des
changements constatés au niveau de l'ADN,, avec la position (P) des
changements constatés au niveau de la protéine. Elle montre aussi que les
protéines plus courtes commencent toujours par la même extrémité (c'est
toujours la fin de la chaîne qui change ou qui manque. Cela montre bien que le
message génétique est lu dans un seul sens.
ADN
i
as
49 10
6 ? 94 SX
US
41*1
PRO
« 45
—.
TH A 5
47 7 / / A 4
, 4 1
-?
^
1£
TAVA <r
, II
THA
1
6
2 2 T/VA 7
. 3 9 Ttf*
2
, 5 9
—
THflS
—22
. 72.
TW/15
Fig. 16.- En haut de la figure, représentation en parallèle de l'ADN et de la
protéine indiquant les sites de mutation. En bas, les protéines mutantes par
tlongueur croissante.
La figure 17 représentant P=f(A) montre la relation de proportionnalité
entre A et P. Le rapport A/P étant proche de 3 suggère que 3 bases azotées
codent pour un acide aminé, ce qui est d'ailleurs démontré en localisant la
position du groupe de 3 bases : elle correspond à P dans tous les cas étudiés.
Position
acide
aminé.
(P)
Position
nucléoticlt
(H)
Fig. 17.- Représentation graphique des positions de changement dans l'ADN
et la protéine correspondante.
L'exploitation de ces comparaisons sur la nature des changements permet de
mettre en évidence tous les types de mutation (substitution.insertion, délétion)
et leurs conséquences, l'importance du cadre de lecture sur la protéine
fabriquée, les triplets particuliers (début de séquence ATG, fin de séquence
TAG, T A A O U T G A ) .
Le caractère redondant du code génétique et la nature des codons seront
montrés en recherchant les codons possibles pour plusieurs acides aminés
présents dans les séquences protéiques (possibilité de superposer gène et
protéine synthétisée ou utilisation de l'option "traduction reverse" ce qui
indique tous les codons possibles pour chaque acide aminé.
2. Quelques utilisations avec les classes de terminale C et D.
Nous proposons ici un schéma expérimenté en 1991-1992 au lycée P.L.
Courier de Tours..
a. L'expression de l'information génétique
Le recours au logiciel a lieu à trois reprises au cours de ce chapitre sous
deux formes : exploitation par les élèves de documents élaborés à partir de la
banque de données, et courte séance d'utilisation du logiciel en petits groupes
se relayant devant la machine disposée dans la salle de TP.
Prérequis : ce chapitre suit celui sur la reproduction conforme. Les notions
nécessaires suivantes sont acquises : ADN (nature, structure, localisation), l'ADN
support d'une information génétique, réplication de l'ADN.
Découpage horaire : en cours, 20 minutes sur documents issus du logiciel ;
en TP, 10 minutes sur machine et une heure sur documents issus de SEQAIDII.
Question : Y-a-t-il un rapport entre existence d'une information génétique et
production d'une protéine ? Si oui lequel ?
- Rapport entre information génétique et protéine
- Un exemple de manipulation génétique ou comment faire
fabriquer de l'insuline de Souris à une Bactérie. Bilan : L'information
génétique d'une fraction d'ADN permet la synthèse d'un polypeptide spécifique.
- Forme de l'information génétique au niveau de l'ADN
Symptômes de la drépanocytose ou anémie falciforme : hématies
anormales, hémoglobine anormale (anomalie repérée au niveau des chaînes
bêta). On connaît le fragment d'ADN permettant la synthèse de cette chaîne.
. Méthode : alignement du gène normal chez un individu normal et
drépanocy taire.
La recherche s'organise autour de trois pistes : comparer les
protéines et identifier les différences (acide aminé numéro 6 ; on numérote à
partir de 0 = méthionine) ; comparer les gènes et identifier les différences
(base numéro 20) ; poser une ou des hypothèses concernant le principe d'une
correspondance.
Bilan
- Existence d'une correspondance entre séquence des nucléotides sur
l'ADN et séquence des acides aminés de la protéine. Les acides aminés sont
désignés au niveau de l'information génétique de manière codée (3 bases pour
1 acide aminé). Il semble qu'un même acide aminé puisse être désigné de
plusieurs façons.
- L'information génétique (gène) gouvernant la synthèse d'une protéine
peut exister sous plusieurs versions (première approche de la notion d'allèles).
b. Passage de l'information génétique du gène à la protéine
Question : l'information génétique est-elle exploitée in situ ?
- L'exploitation de l'information génétique
Autoradiographies montrant que chez les eucaryotes, la synthèse de la
protéine n'est pas réalisée dans le noyau mais dans le cytoplasme, et qu'une
substance, l'ARNm, quitte le noyau pour le cytoplasme.
Question : l'ARNm est-il porteur de l'information génétique nécessaire à la
synthèse de la protéine ? On cherche à préciser la structure de l'ARNm et la
forme de l'information génétique qu'elle porte.
Les expériences de Nierenberg et Ochoa (fabrication d'ARNm de synthèse
poly U, poly C, etc.) sont relatées pour mettre en évidence l'existence d'une
relation directe entre l'ARNm (le logiciel ne permet pas l'introduction de
séquences dARN au clavier).
Les élèves disposent ensuite d'un document présentant l'alignement d'une
portion d'ARNm gouvernant la synthèse d'une chaîne de l'hémoglobine
(obtenue par conversion d'une séquence HBCODADN de la banque de données)
avec la protéine produite (par souci de clarté, nous avons décidé de ne
travailler que sur la codification 3 lettres). Les documents correspondant aux
différentes chaînes de l'hémoglobine disponibles (alpha, bêta, gamma, delta)
sont réparties entre les élèves.
Question : qu'apprend-on à travers ce document sur la forme de
l'information génétique au niveau de l'ARNm ? Comment les acides aminés
sont-ils codés ? Etablir une table de transcodage.
Durée du travail : 20 minutes.
Bilan : notion de codon, tableau du code génétique (hormis les codons STOP
que l'on découvrira sur un document de référence), caractéristiques du code
génétique, nécessité d'une transcription en amont et d'une traduction en aval.
La multiplicité des documents accrédite la généralité du codage des acides
aminés et permet de réunir des informations très complètes.
- La transcription de l'information génétique
Description du mécanisme.
- La structure de la molécule d'ARNm en rapport avec sa traduction
Question : Dans l'étude précédente, on a considéré une portion de la
molécule d'ARNm. Qu'en est-il si on considère toute la molécule d'ARNm
transcrite ? Quelle est sa structure ?
Chaque élève dispose de la séquence complète d'ARNm gouvernant la
synthèse d'une chaîne de l'hémoglobine. Chacun fait traduire par le logiciel la
séquence étudiée. Il note les arrêts et le nombre d'acides aminés traduits à
chaque fois. Il remarque que cette traduction fictive est souvent interrompue et
qu'elle aboutit à un nombre d'acides aminés supérieur à celui de la protéine
réelle, d'où l'idée que tout l'ARNm n'est pas traduite en protéine.
Le travail se poursuit sur papier par l'exploitation convergente des
informations notées los de la traduction fictive : il s'agit de repérer sur l'ARNm
complet la zone réellement traduite en protéine, d'en déterminer les
caractéristiques (début, fin), de confronter les résultats obtenus par les
différents groupes pour en tirer une idée générale, de schématiser la structure
de l'ARNm.
Question : Les zones non traduites ont-elles une fonction ?
La réponse passe par l'analyse des mécanismes de la traduction. Cette partie
est réalisée de manière traditionnelle.
b. Gènes et génie génétique
Ce chapitre suit ceux qui traitent de la reproduction sexuée et le brassage de
l'information génétique et qui ont débouché sur l'hérédité humaine : des cas
d'affections d'origine génétique (myopathie, drépanocytose, thalassémies, etc.)
ont été envisagés dans leurs aspects symptomatiques et leur mode de
transmission.
Dans ce chapitre, nous avons pu utiliser le logiciel comme un outil de
découverte du gène et de ses caractéristiques. Nous disposions de quatre
machines en salle de TP, dont une munie d'un grand écran de visualisation.
Le thème vise à traiter les questions suivantes :
- Qu'est-ce qu'un gène ? A-t-il une structure particulière ?
- Qu'est-ce que le génome ? A-t-il une structure particulière ?
- Comment le gène fonctionne-t-il ? Peut-on le faire exprimer en dehors
de la cellule d'origine ?
Le logiciel permet de traiter le premier thème : le travail est organisé sous
forme de séquences courtes (15 à 20 minutes) Chaque groupe d'élèves cherche
les réponses concernant une molécule différente. Chaque séquence débouche
sur une mise en commun des informations et sur leur exploitation collective,
une synthèse amenant aux notions essentielles et une concrétisation sur des
documents issus du logiciel et préparés à l'avance pour que chacun garde une
trace documentaire. En effet, pour gagner du temps et tenant compte du
manque d'imprimantes en nombre suffisant, tout le travail est effectué sur
écran.
- Les caractéristiques du gène chez les eucaryotes
Question : l'information génétique pour une protéine est-elle la même chez
tous les individus ?
- Une diversité pour un même gène : notion d'allèles
Le travail s'effectue sur le gène codant pour la chaîne bêta.
Alignement pour trouver les différences entre une séquence de référence
( H B B C O D , la plus répandue = normale) et différentes autres séquences
( H B B T H A l à H B B T H A 8 extraites de la banque de données). Noter précisément
la nature des différences et leur position.
Bilan : il existe plusieurs versions d'un gène, ou allèles. Par rapport au gène
normal, les différences résultent de délétions, substitutions, insertions
(mutations). Dans ce cas, celles-ci aboutissent à des anomalies de
l'hémoglobine, affections héréditaires appelées thalassémies. On effectue une
synthèse sur des documents.
Question : Quelles sont les conséquences de telles mutations ?
Pour des raisons de temps, la recherche se fait sur des documents qui
mettent en parallèle les séquences précédemment étudiées sous forme d'ARNm
et les protéines correspondantes.
On émet ainsi des hypothèses concernant les effets des mutations : protéines
non conformes (remplacement d'un acide aminé par un autre) ou écourtées
(codons S T O P ) .
- La structure du gène
• Le repérage d'un gène sur l'ADN des eucaryotes : après
présentation de la technique d'hibridation moléculaire (ADN-ARNm),
l'exploitation d'un document permet d'émettre l'hypothèse suivante : tout le
contenu de l'ADN ne se retrouve pas dans l'ARNm. L'utilisation du logiciel va
permettre de tester cette hypothèse.
• Comparaison ADN-ARNm : après avoir montré qu'on peut
créer un ADNc qui est l'image de l'ARNm, le travail suivant est proposé :
utilisation du logiciel (15 minutes) pour l'alignement du gène et de l'ADNc.
Travail à réaliser : comparer la longueur de l'ADNc et du gène,; faire un
relevé sous orme schématique des zones communes, des zones propres à
l'ADNc et de leurs positions, ceci pour le gène HLA3, les gènes alpha, bêta,
gamma et delta de l'hémoglobine, et les ADNc correspondants.
Le travail se fait sur écran ; chaque groupe travaillant sur une molécule
différente établit un schéma de l'alignement, puis le reporte sur le tableau. On
peut ainsi facilement généraliser la structure d'un gène d'eucaryote.
. Bilan : Toutes les bases de l'ADN ne se retrouvent pas dans
l'ARNm. On constate des zones non transcrites (une partie initiale ou zone
promotrice -promoteur- et des zones à l'intérieur du gène -introns-), et des
zones transcrites (exons). On fonde ainsi la notion de gène morcelé.
• On expose le mécanisme de la transcription du gène morcelé en
ARNm : rôle du site promoteur, l'ARN pré-messager, l'adjonction de la coiffe
et de la queue, l'épissage.
Toutes les mutations ont-elles les mêmes conséquences ? On
connaît différentes thalassémies dont certaines ne sont pas sévères. Pourquoi ?
Méthode d'exploration : comparer le gène muté et le gène normal,
rechercher la mutation et, en utilisant ce qui a été acquis sur la structure du
gène codant pour la chaîne bêta de l'hémoglobine,, proposer des hypothèses
explicatives de la faible sévérité de certaines thalassémies.
On peut ainsi comprendre que les mutations localisées soit dans le
promoteur, soit à la limite intron-exon n'affectent pas l'information génétique
transcrite
IV. E T U D I E R L ' E V O L U T I O N A P A R T I R D E D O N N E E S M O L E C U L A I R E S
L'aspect moléculaire de l'évolution a été le deuxième choix fait dans cette
recherche en biologie moléculaire.
L'idée d'évolution des espèces ne peut aller sans faire une classification du
monde vivant au préalable ; or ce classement (systématique) nécessite des
critères parmi lesquels on peut citer : la morphologie, l'anatomie, l'éthologie,
la physiologie et la biochimie. En 1966 Hennig établit une classification
compatible avec l'évolution : c'est la systématique phylogénétique ou
cladistique réunissant tous les êtres vivants. Si deux espèces A et B ont plus de
caractères en commun entre elles qu'avec une 3ème espèce C, l'ancêtre
commun (fossile) à A et B est moins ancien que l'ancêtre commun (fossile) aux
trois espèces. Les arbres généalogiques ci-dessous illustrent cette systématique
cladistique obtenue à partir de caractères morphologiques et anatomiques.
(
8/ 46)
Fig. 18.- Arbre phylogénétique
des différents ordres de
(
(
(
(
(
8/
8/
3)
3)
8
8
8/ 4)
8
8
8/ 1)
8
8/ 12)
CD
— Monotrènes
— Marsupiaux
— Edentés
—Pholidotes
— Carnivores
— Tubulidentés
— Insectivores
— Chiroptères
— Dernoptères
—Priaates
— Scandentia
—Hacroscélides
— Lagomorphes
— Rongeurs
— Artiodactyles
— Cétacés
—Périssodactyles
—Hyracoïdes
— Théthythériens
(
8/
8/
8/
(
8/
(
8/
(
(
B
3)
5)
co
Mannifères
B
4)
8
3)
Mammifères.
Pourquoi utiliser des caractères biochimiques pour établir une phylogénie ?
Certaines molécules de la vie sont porteuses d'information : les protéines
(dont la structure primaire est établie à partir de 20 caractères différents : les
acides aminés) et les acides nucléique (séquences réalisées à partir de 5
caractères : les bases azotées A,G,C,T,U).
Le caractère a ici un aspect irréductible par sa nature et sa place dans la
séquence ; si un acide aminé est à un endroit précis dans une protéine, la
probabilité pour que ce soit du au hasard est de 1/20 = 5% et si quatre acides
aminés déterminés se suivent la probabilité d'une occurrence de cette suite au
hasard sera alors de 1/20 x 1/20 x 1/20 x 1/20, donc beaucoup plus faible. En
ce qui concerne un acide nucléique, pour qu'un nucléotide soit à un site la
probabilité est de 1/4 = 25%.
On retrouve des molécules jouant des rôles comparables chez de nombreuses
espèces animales et végétales exemple : le cytochrome C de la chaîne
respiratoire, les histones associées à l'ADN, les facteurs d'élongation, l'ARN 28
S, des ribosomes, les globines chez les vertébrés, etc. Ces molécules observées
actuellement sont l'aboutissement d'une longue histoire durant laquelle elles ont
été modifiées. En comparant deux molécules il est possible de déterminer leur
degré de similitude, et donc de détecter si le pourcentage de ressemblance est
supérieur à 5 % pour une protéine et supérieure à 2 5 % pour un acide
nucléique.
Les problématiques abordées avec les molécules seront :
- notion d'homologie : gènes homologues, gène ancestral, duplication du
gène,
- mise en évidence des divers types de mutations (substitutions, insertions,
délétions), mutations silencieuses,
- notions d'horloge moléculaire, vitesse différente d'évolution suivant les
molécules considérées,
- mise en évidence de régions stables et de régions instables (variables) dans
les molécules étudiées,
- Comment construire des arbres phylogénétiques et discussion de la validité
des résultats obtenus.
A. Fonctionnalités
du
logiciel
EVOLUTION MOLECULAIRE
Le menu principal du logiciel donne accès à six modules. Le premier est à
finalité purement didactique, alors que les cinq autres décomposent de manière
transparente les étapes allant de la sélection d'une molécule et de la constitution
d'une liste d'espèces jusqu'à la construction d'un arbre phylogénétique.
MENU GENERAL
Alignement de séquences
E x t r a c t i o n de séquences a l i g n é e s
V i s u a l i s a t i o n de séquences e t de m a t r i c e s
Calcul d'un a r b r e
J
V i s u a l i s a t i o n d un a r b r e
Comparaison de matrices
Retour à MS-DOS
Fig. 19.- Menu général du logiciel EVOLUTION MOLECULAIRE.
Pour toute étude phylogénétique complète, le point de départ est toujours la
banque de données disponibles (l'utilisateur ne peut pas introduire ses propres
séquences). Actuellement, cette banque comporte deux types de données :
- des séquences non alignées qui sont utilisées par le premier module
seulement (énumérer les molécules présentes).
- des séquences préalignées qui seront le support des études phylogénétiques.
Ces dernières relèvent de molécules ayant des vitesses d'évolution différentes
permettant des recherches de phylogénies à l'échelle des vertébrés (famille des
globines alpha, bêta, myoglobine) et à l'échelle du monde vivant (cytochrome
C, facteur d'élongation EF1 alpha). La séquence de chaque molécule est donnée
pour des espèces nombreuses appartenant aux principaux groupes
taxonomiques (exemple : une portion du gène alpha de l'hémoglobine est
donnée pour 24 espèces de vertébrés). Une information est associée à chaque
molécule.
L'utilisateur doit choisir de travailler sur l'un ou l'autre type de séquences et
sélectionner une des molécules mises à sa disposition. Ce choix lui donne accès
à un arbre phylogénétique initial, construit indépendamment du logiciel sur des
bases à la fois morphologiques et anatomiques. Cet arbre représente, en
quelque sorte le consensus actuel sur la classification des groupes et des espèces
concernées.
Vivant
(
8/ 37)
-Eubactéries
- Archébactéries
-Diplowonadines
-Hicrosporidies
-Euglenozoa
- Trichononadines
- Myxomycètes
- Acrasiowycètes
-Sporozoaires
-Ciliés
-Dinoflagellés
-Champignons
- Chromophytes
-Cryptomonadines
- Rhodophytes
-Chlorophytes—•
Amibes
Actinopodes
Métazoaires—•
(
(
(
0/ 16)
8/ 4)
8
0
8/ 1)
e
(
(
(
8
8
B
0
0
0/ 4)
0
0
0
0/ 2)
0
0
0/ 10)
Fig. 20.- Arbre du vivant proposé par le logiciel pour le choix des groupes
avec la molécule EF1 alpha..
1. Choix des espèces
Pour chaque molécule, et pour chaque groupe, une indication précise est
fournie sur le nombre d'espèces (donc de séquences) présentes dans la banque.
L'utilisateur peut accéder à des informations détaillées sur les groupes et les
espèces. En ce qui concerne ces dernières, par exemple, les informations
comportent : une description anatomique succincte, le rappel de quelques
représentants de l'espèce connus des élèves, les caractères spécifiques, une
estimation du nombre d'espèces actuelles et de leurs répartition géographique,
des éléments d'éthologie, les dates d'apparition des premiers fossiles connus,
etc. Ces informations guident en partie le choix des espèces à étudier.
L'utilisateur accède à la liste des espèces désignées par le nom familier en
français. Il peut en sélectionner quelques unes ou retenir globalement tout le
groupe. Les séquences sont ensuite visualisées. Le logiciel donne la possibilité
de parcourir les séquences avec repérage des positions des résidus, de changer
l'ordre des espèces, de présenter les séquences nucléiques et les séquences
protéique en parallèle, etc.).
Pour la molécule et les espèces choisies, un fichier est ensuite créé (on peut
ainsi sélectionner d'autres molécules et d'autres espèces qui seront rangées dans
d'autres fichiers).
2. Travail sur des séquences non alignées
Ce module permet d'introduire le concept d'homologie moléculaire par la
recherche de la meilleure similitude.
L'élève choisit une molécule et ensuite les espèces pour lesquelles il veut
comparer la composition chimique de cette molécule. Le logiciel affiche les
différentes séquences non alignées.
En plaçant à certains endroits des astérisques, on peut mettre
progressivement en évidence les ressemblances et différences entre les
séquences. Pour obtenir la ressemblance maximale, il faut un minimum
d'astérisques pour un maximum de similitude des séquences (principe
d'économie d'hypothèses).
Dans la recherche de phylogénies, l'alignement des séquences détermine
toutes les analyses et tous les traitements ultérieurs. Seul un chercheur
expérimenté (ou un logiciel performant) peut réaliser correctement cet
alignement qui ne peut donc être laissé à la charge des élèves. C'est pourquoi
les autres fonctionnalités du logiciel utilisent exclusivement des séquences
préalignées.
3. Travail sur des séquences alignées
Ce travail peut se dérouler en quatre étapes : sélection d'une molécule et
d'espèces comme déjà indiqué et visualisation des séquences, calcul et
visualisation de la matrice des distances, calcul et visualisation d'un arbre
phylogénétique, et enfin comparaison des données issues de deux matrices des
distances obtenues pour les mêmes espèces avec deux molécules différentes
ESPECES
Requin de port
Carpe cormune
Echidné
Home
Chimpanzé
Coq domestique
Alligator amer
Opossun de IPir
Chien
Séquences alignées
STSTSTSDYS AADRAELAAL SKULAQNAEA FGAEALARMF
*******SL- DK-K-AUKIA UAKISPK-DD I
G—L
******HfcT D-EKK-OTS- WGXASGH—E YE-LI H H H H H H . U L - P-KTT1UK-A UGKUGAH-GE Y — — E —
« * • * « « « , - P-KTT1VK-A UGXUGAH-GE YE—
»******UL
KNMUKGI FTKI-GH—E Y—T-E
*-******UL- ME-KSNUK-I WGKASGHL-E YE—
« H H H H « U L - -M-KTMUKGA USKUGG-SG- YrtG—Y-T**«****UL- P—KTNIKST UDKIGGH-GD Y-G—D-T-
Fig. 21.- Exemple de séquences de globines
alignées.
TWAATKSYF
—PQ--T—
LSFPT--T-LSFPT—T—
LSFPT--T-T-PP--T-CA-PQ—I—
LSFPT—T—
QSFPT-T—
*
KDYKDFTAAA
AHUA-LSPGS
SHM-LSKGS
PHF*-LSHGS
PHF-LSHGS
PHF*-LSHGS
PHF*-MSHNS
PN-*--S-GS
PHF*-LSPGS
a. Calcul et affichage d'une matrice des distances
La sélection d'un fichier de séquences donne lieu ensuite au calcul de la
matrice des distances qui sera ensuite visualisée. Cette matrice montre les
différences entre les séquences comparées deux à deux. Les valeurs peuvent
être exprimées en fréquence ou en nombre réel de différences. La matrice est
automatiquement sauvegardée dans un fichier qui sera utilisé par les modules
suivants.
Requi Carpe Echid Homme Chimp Coq d Allig Oposs Chien
Requin de p o r t - j a c
Carpe commune
Echidné
Home
Chimpanzé
Coq domestique
Alligator américai
Opossum de Uirgini
Chien
9
289
279
272
272
268
276
274
279
9
242
229
229
221
258
241
236
9
93
94
139
184
129
199
9
1
124
176
97
61
9
124
176
98
62
9
141
144
124
9
175
177
9
119
9
Fig. 22.- Matrice donnant le nombre de différences entre les globines
les 9 espèces.
pour
b. Calcul et affichage d'un arbre phylogénétique
En sélectionnant un fichier de matrice cette fonction permet de calculer
l'arbre phylogénétique selon la méthode du Neighbor Joining et ensuite de le
visualiser à l'écran L'arbre visualisé est enraciné automatiquement par le
logiciel entre le premier groupe identifié et tous les autres. De ce fait, cet
enracinement est le plus souvent inadéquat. L'utilisateur peut le modifier en
utilisant ses connaissances sur les espèces (sachant par exemple qu'une espèce
est manifestement très différente des autres) et raciner l'arbre à un autre noeud
(point de départ de deux branches de l'arbre). Il peut également modifier
l'aspect de l'arbre en faisant pivoter les branches autour des noeuds.
'
Requin de port-jackson
I
i
["•I
|
Carpe comnune
Alligator anéri
Coq domestique
Ch ien
C Chinpanzé
- Echidné
Opossun de Uirginie
Fig. 23.- Arbre phylogénétique
des 9 espèces.
Il faut noter que les longueurs des branches reflètent les valeurs calculées
dans la matrice des distances. Ceci n'est pas vrai pour les deux premières
branches de l'arbre tel qu'il est automatiquement enraciné par le programme.
Il est cependant possible de modifier la longueur de ces branches en se référant
à la matrice des distances.
Les arbres ainsi obtenus sont sauvegardés automatiquement. L'arbre
"calculé" tracé sur imprimante peut être comparé à l'arbre cladistique présenté
lors du choix des espèces, cela peut permettre d'apprécier la fiabilité et la
cohérence des résultats entre deux molécules différentes pour les mêmes
espèces.
c. Comparaison de deux matrices
Une autre façon de tester la cohérence entre les informations fournies par
deux molécules différentes pour une même liste d'espèces consiste à utiliser le
module "comparaison de matrices". Après avoir sélectionné les deux matrices
correspondant aux deux molécules, le logiciel visualise dans un repère
orthogonal les "distances" calculées dans les deux matrices. Chaque point
représente un couple d'espèces A et B. Il a pour abscisse la distance calculée
entre ces deux espèces pour l'une des molécules et pour ordonnée la distance
calculée pour l'autre molécule.
A partir du nuage de points obtenu le logiciel trace la droite de régression et
calcule le coefficient de corrélation entre les deux matrices. Il est possible de
visualiser les couples d'espèces (localisation de chaque point) et de connaître
l'éloignement des points par rapport à la droite de régression. Il est également
possible d'identifier par un code couleur les espèces appartenant à deux
groupes pour examiner leur disposition sur la droite de régression.
B. Utilisations pédagogiques
L'utilisation expérimentale du logiciel s'est déroulée au cours des années
1991 et 1992 dans six lycées. Cette mise en oeuvre dans les classes a
accompagné l'adaptation du logiciel pour passer de l'instrument de recherche
initial à un produit utilisable dans l'enseignement. Les transformations du
logiciel ont concerné principalement :
- l'interface d'échange avec l'utilisateur : création des menus d'appel
transparents des fonctions,
- la réalisation de visualisations spécifiques pour l'enseignement : travail sur
des séquences non alignées, affichage en parallèle de deux séquences nucléique
et protéique, visualisation à l'écran, en valeurs absolues et en effectifs, de la
matrice des différences,
- l'adoption d'une nomenclature en français courant des noms des espèces et
des groupes (dénominations savantes initialement),
- la conception d'une base d'informations associée à tous les groupes et à
toutes les espèces,
- l'introduction d'une aide systématique dans tous les modules,
- le tri croisé afin de sélectionner les espèces pour lesquelles on possède des
séquences dans différentes molécules.
Quatre des lycées associés à l'expérimentation des versions successives du
logiciel disposaient d'un nombre suffisant d'ordinateurs pour faire travailler
les élèves en groupes de deux ou trois, ce qui permet de leur laisser une
relative autonomie. Trois ordinateurs seulement étaient disponible dans l'un
des établissements (les groupes d'élèves sont donc plus nombreux). L'utilisation
collective du logiciel avec une tablette de rétroprojection a également été
pratiquée avec un groupe de TP de 15 élèves.
Suivant les cas, la longueur des séquences d'utilisation varie de 15 minutes
(petites séquences répétées, dans un établissement disposant d'ordinateurs
installés à demeure dans la salle de TP) jusqu'à 2 heures. De ces utilisations on
peut dégager un certain nombre de thèmes répondant aux diverses
problématiques et intégrés dans l'enseignement en terminale D. Le logiciel
parait potentiellement très riche et l'exploitation qui peut en être faite déborde
le contenu du programme actuel.
De cette expérimentation il ressort que le logiciel EVOLUTION MOLECULAIRE
apporte une aide importante aux élèves pour faciliter la compréhension de cette
partie du programme souvent traitée de façon abstraite et peu attractive. La
prise en main du logiciel est aisée et au fur et à mesure de la progression les
élèves peuvent prendre de plus en plus d'autonomie dans leur travail.
Les grandes problématiques sont abordées au cours des thèmes décrits ici et
des réflexions critiques apparaissent au cours de l'utilisation de ce logiciel
montrant à nos élèves combien de précautions il faut prendre avant d'affirmer
un résultat. Ce logiciel est un instrument indispensable pour traiter des données
nombreuses et importantes (longues séquences d'acides aminés et
nucléotidiques) il aide à la réflexion sur l'aspect moléculaire de l'évolution
mais on ne doit pas conclure trop rapidement sur l'exactitude de la phylogénie
trouvée à notre niveau de Terminale.
1. Familiarisation avec la classification phylogénétique des vertébrés
Classification et évolution sont "liés", la systématique cladistique en est la
démonstration. Toute classification est basée sur des caractères que certaines
espèces ont en commun et permettent de les regrouper. Il est possible en
utilisant les informations données dans le logiciel de relever les principaux
caractères anatomiques de chaque groupe de vertébrés et d'indiquer la date
(l'âge) des plus anciens fossiles connus.
Une étude de ce type peut être menée à propos de "la sortie des eaux des
vertébrés" : origine des Tétrapodes, recherche de lien de parenté entre
Poissons et ICTHYOSTEGA).
L'élève recherchera les caractères existant chez les Tétrapodes et partagés
avec un groupe de Poissons, ce qui fournit des arguments pour avancer que ces
groupes ont un ancêtre commun.
Un arbre de parenté probable (cladogramme) sera construit manuellement
par les élèves et comparé à celui tracé par le logiciel (quand on choisit les
espèces).
Ce premier thème familiarise de manière simple avec les groupes
taxonomiques et avec les espèces que les élèves connaissent peu. Il permet de
mettre en place les principes de construction d'arbres phylogénétiques qui
seront rencontrés ultérieurement.
2. Notions d'homologie, de mutation et de contrainte fonctionnelle
a. Au niveau d'une protéine
Les parentés biochimiques entre plusieurs molécules (les myoglobines par
exemple) d'espèces différentes sont analysées grâce au module "alignement de
séquences". La visualisation de ces molécules superposées montre :
- qu'elles se ressemblent d'autant plus que les groupes sont plus proches
phylogénétiquement,
- qu'il est possible d'obtenir un alignement pour lequel le nombre de
différences entre les molécules est le plus faible en introduisant des astérisques
dans les séquences ; l'astérisque pouvant correspondre soit à une insertion
d'acide aminée ou à une délétion. Quand un acide aminé est remplacé par un
autre on aura substitution (cela ne nous renseigne pas précisément sur la nature
des mutations au niveau de l'ADN).
- Certaines parties de la molécule sont conservées alors que d'autres sont très
variables d'un groupe à l'autre. Les parties conservées sont elles en rapport
avec la fonction de la protéine ?
b. Au niveau de l'ADN
Le travail sur des séquences préalignés (exemple: portion du gène codant
pour une chaîne de l'hémoglobine chez les Mammifères) permet de mettre en
évidence les différents types de mutations (insertion, délétion, substitution)
ainsi que leur localisation (dispersée ou groupée).
Par l'alignement simultané ADN-Protéine les élèves se rendent compte que
certaines mutations n'ont aucune conséquence au niveau de la protéine
(mutation silencieuse ou neutre ne changeant pas le phénotype et ne pouvant
donner prise à la sélection naturelle). Les élèves ont ainsi une approche du
code génétique et de son caractère dégénéré. Au niveau de l'ADN les mutations
apparaissent n'importe où alors que pour la protéine il existe des zones
constantes et des zones variables. Cela pose le problème de la contrainte
fonctionnelle : lorsqu'une mutation a pour conséquence un mauvais
fonctionnement de la protéine, les organismes porteurs de cette mutation seront
éliminés : les zones constantes de la protéine sont donc probablement en
rapport avec sa fonction.
3. Réponses à un problème de parenté entre groupes
Exemple de la détermination de la classification phylogénétique :
Mammifères, oiseaux, crocodiliens. Les oiseaux présentant des caractères
communs avec les Mammifères d'une part et avec les crocodiles d'autre par,
sont-ils plus proches des Mammifères ou des crocodiles ? Cette étude permet
de poser les principes du traitement des données qui aboutissent à la
construction d'un arbre phylogénétique et de discuter de la fiabilité du résultat
obtenu avec une molécule si on utilise d'autres molécules pour construire
l'arbre.
Ainsi, en travaillant sur les globines alignées (les alphaglobines par
exemple), l'élève choisit une espèce dans dans les trois groupes et une espèce
dite "extérieure" dont l'ancêtre est commun aux 3 espèces précédemment
choisies (ici un poisson par exemple). Le nombre de différences entre deux
alphaglobines sera calculé sur les quatre espèces choisies (prises 2 à 2) et un
tableau est dressé (matrice des distances). L'exploitation de la matrice est faite
par les élèves en utilisant la méthode dite "UPGMA" (on rassemble les espèces
proches en moyennant leur distance par rapport à une 3ème ayant plus de
différences). Cette méthode suppose que les molécules évoluent à vitesse
constante chez toutes les espèces (ce qui n'est pas toujours vrai).
Cette méthode permet un travail autonome des élèves mais construit une
phylogénie imprécise si le principe de l'horloge moléculaire n'est pas vérifié
pour toutes les espèces. Parallèlement à ce travail "manuel" l'élève utilisera le
logiciel pour calculer l'arbre à partir des résultats de la matrice des distances.
Ce calcul d'arbre repose sur un traitement statistique dont le principe est de
choisir "l'arbre" le plus proche des résultats de la matrice des distances (c'està-dire en faisant en sorte que la différence soit la plus petite entre les distances
indiquées dans la matrice et les distances calculées dans l'arbre). L'élève
choisira la "racine" en désignant un groupe "extérieur" en fonction des
informations qui lui seront données (ici un poisson).
La signification des longueurs différentes des branches pourra être abordée :
sachant que la longueur des branches qui relient deux espèces est
proportionnelle au nombre de différences entre les deux séquences concernées,
si une branche terminale est plus longue que les autres cela signifiera que la
molécule correspondant à cette espèce a beaucoup changé au cours du temps,
donc a subi plus de mutations et a une vitesse d'évolution plus grande.
Par une démarche semblable, l'élève travaillera sur les autres globines avec
les mêmes espèces et pourra constater que les arbres obtenus ne sont pas tous
identiques au premier : ainsi se trouve posé le problème de l'échantillonnage,
une protéine (expression d'un gène) n'est pas suffisante pour être
représentative du génome ; aussi, le travail réalisé avec les 3 protéines alpha,
bêta et myoglobine mises bout à bout donnera un arbre plus fiable.
4. Rythme d'évolution des molécules chez les vertébrés
En choisissant des molécules différentes (histones, cytochrome C,
alphaglobine, bétaglobine, myoglobine) chez les mêmes espèces et après avoir
calculé les matrices des distances pour chaque molécule, il est possible de noter
les différences entre les espèces considérées et l'Homme pour chaque molécule.
A l'aide d'un document datant la séparation des différentes lignées de
vertébrés, l'élève pourra représenter graphiquement les différences (par
rapport à l'Homme) en fonction du temps écoulé depuis la séparation des
lignées.
Les courbes montrent que chaque molécule a sa propre vitesse d'évolution
des histones très stables aux globines beaucoup plus changeantes. L'horloge
moléculaire fonctionne différemment selon les types de molécules considérés.
L'étude serait plus fiable si l'échantillonnage en espèces était beaucoup plus
important pour pouvoir tester l'hypothèse de l'horloge moléculaire au niveau
d'un type de molécule.
Oiffirmmcm.
Requin Carpe Tmon Pouiet ini gourou Chien Homme
Fig. 24.- En a : période estimée de séparation des lignées chez les Vertébrés.
En b : représentation graphique des différences par rapport à l'Homme en
fonction du temps écoulé depuis la séparation des lignées.
5. Réalisation de quelques phylogénies
Par rapport à ce qui a été montré dans les thèmes précédents, les élèves, en
autonomie, doivent :
- Se poser le problème du choix de la molécule selon la nature de la
phylogénie recherchée. Soit globines pour les vertébrés, soit cytochrome C ou
facteur d'élongation pour le monde vivant ; le choix est déterminé par la
vitesse d'évolution de ces molécules.
- Se poser le problème d'un échantillonnage pertinent : au moins 2 espèces
par groupe, celles-ci étant représentatives de la variété du groupe.
- Réaliser toute la démarche à partir des séquences alignées choisies (calcul
de matrice, calcul de l'arbre, visualisation et enracinement).
- Repérer les contradictions par rapport à l'arbre présenté dans le logiciel
lors du choix des espèces.
- Repérer les contradictions en comparant les résultats obtenus pour deux
molécules différentes chez les mêmes espèces. Cette partie peut être réalisée en
comparant visuellement les deux arbres obtenus et imprimés, ou en utilisant le
module "comparaison de matrices" (cette partie n'a pas été expérimentée).
L'utilisation du facteur d'élongation EF1 montre que le monde vivant se
subdivise en 3 parties : eucaryotes, archéobactéries et eubactéries (ce qui exclut
le terme de procaryotes dans un sens phylogénétique). Les eucaryotes
apparaissent plus proches des archéobactéries que des eubactéries. Sachant que
les bactéries sont apparues bien avant les eucaryotes elles apparaissent dans
l'arbre beaucoup plus diversifiées du point de vue biochimique (les caractères
morphologiques ne sont pas adaptés pour différencier ces êtres unicellulaires
les uns des autres.
Mitochondrie
Chloroplaste
Chloroplaste
Chloroplaste
Chloroplaste
Micrococcus
Mycoplasma
Escherichia
de
de
de
Levure
Cryptomonas
Chlaraydomonas
d'Euglène
d'Astasia
luteus
gallisepticum
coli
Tomate
Euglène
Levure
de
Candida
r
Souris
boulangerie
albicans
domestique
Homme
Mouche
du
vinaigre
Methanococcus
vannielii
Halobacterium
Sulfolobus
4 . 6 2 % de
marisraortui
acidocaldarius
différences
Fig. 25.- Arbre du vivant calculé pour la molécule EF1 alpha.
La molécule E F 1 permet aussi d'aborder le problème de l'origine des
chloroplastes et mitochondries de la cellule eucaryote. Ces organites possèdent
une information génétique propre qui permet en particulier la synthèse du
facteur d'élongation EF1 qui se trouve être différent de celui fabriqué par la
cellule eucaryote. En introduisant chloroplaste et mitochondrie dans leur
recherche, les élèves constateront que les séquences EF1 de chloroplaste et de
mitochondrie présentent une similitude avec celle des eubactéries (ce qui
accrédite l'idée d'une symbiose originelle entre eucaryotes et bactéries (futures
organites chloroplaste et mitochondrie).
6. Duplication de gènes
La mise en évidence de l'existence d'une similitude entre certaines protéines
chez un individu conduit à penser qu'elles sont homologues : elles dériveraient
d'une molécule ancestrale. Les protéines étant l'expression des gènes, on peut
supposer un seul gène à l'origine (gène ancestral) qui se serait dupliqué. Les
deux gènes "fils" auraient évolué indépendamment l'un de l'autre par mutations
successives. Chaque gène "fils" pouvant aussi se dupliquer au cours de cette
évolution : c'est ainsi que l'on peut obtenir une famille multigénique.
En prenant l'exemple des globines plusieurs duplications auraient eu lieu.
Les élèves peuvent sélectionner chez l'homme toutes les globines (myoglobine,
alpha, bêta, gamma, epsilon, zeta globine) et en suivant la démarche décrite
pour établir une phylogénie, construire l'arbre phylogénétique des globines.
Myoglobine
d'Homme
Zêta
Alpha
-
Bêta
d'Homme
d'Homme
d'Homme
Epsilon
Gamma
3.68%
de
d'Homme
d'Homme
différences
Fig. 26.- Arbre phylogénétique
des différentes globines chez
l'Homme.
V - CONCLUSIONS ET PERSPECTIVES
A partir des caractéristiques des logiciels et des données utilisés, et tenant
compte de l'évolution probable des programmes d'enseignement en cours de
redéfinition, plusieurs axes de travail peuvent être évoqués
1. Sur le plan pratique et à court terme, assurer une réelle disponibilité des
instruments pour tous les établissements scolaires. Ceci est réalisé en ce qui
concerne le logiciel EVOLUTION MOLECULAIRE qui est déjà publié. S'agissant
du logiciel SEQAIDII, le souci d'efficacité incite, d'abord, à rendre cette version
accessible, plutôt que d'envisager une refonte, voire une réécriture totale. La
réalisation d'une version française du logiciel, diffusable sans but lucratif, a
déjà été autorisée par les auteurs ; elle est déjà très avancée et sera distribuée
avant l'été 1993. Une nouvelle version éventuelle devrait assurer, notamment,
l'alignement multiple de séquences, comporter une dimension graphique
moderne et offrir une meilleure convivialité dans l'affichage et le parcours des
longues séquences.
Pour compléter ces logiciels, deux objectifs majeurs semblent à retenir :
- l'extension de la banque de séquences associée au logiciel SEQAIDII :
celle-ci a fortement progressé et sera à poursuivre pour offrir des séquences
de référence correspondant à de nouveaux exemples ou à de nouveaux thèmes
de travail possibles. Cette banque sera elle aussi distribuée sans charges.
- la recherche ou la réalisation d'un logiciel qui assure l'acquisition
active des connaissances sur les espèces et les groupes systématiques, qui
constituent des préalables à la compréhension de l'évolution sur le plan
moléculaire. Dans le même esprit que le logiciel EVOLUTION MOLECULAIRE,
c'est-à-dire en gardant une perspective évolutionniste, ce nouvel outil devrait
permettre d'aborder les problèmes avec des données anatomiques et
morphologiques. Le logiciel MacClade (qui tourne sur matériels Macintosh)
pourrait servir de base de départ pour la conception. Celle-ci peut maintenant
bénéficier des instruments récents permettant la saisie et la gestion souple (par
numérisation) de l'iconographie indispensable. Le Muséum National d'Histoire
Naturelle pourrait être un partenaire dans ce projet.
2. Sur le plan de la recherche pédagogique, il est souhaitable que soit étudié
l'impact des approches et des instruments proposés, mieux que nous avons pu
le faire jusqu'à maintenant puisque nous avons privilégié les aspects
instrumentaux.
Ceux-ci étant maintenant disponibles pour des actions significatives en
contenu et en durée d'utilisation potentielle, des analyses plus fines et plus
fiables sont réalisables. Il est en particulier important de savoir dans quelle
mesure les activités devenues possibles contribuent à une meilleure maîtrise des
notions fondamentales enseignées, notamment une compréhension plus précise
des relations génotype- phénotype, des concepts d'espèce et de temps.
3. En ce qui concerne les développement qui se situent dans l'orientation
majeure inspirant ce travail, à savoir les relations entre évolutions
scientifiques, innovations technologiques et renouvellements disciplinaires, les
explorations pourraient préparer des applications favorisant l'étude des
facteurs biochimiques explicatifs des phénomènes biologiques. Il s'agit en
particulier d'étudier comment et avec quels instruments, l'enseignement peut
faire accéder activement les élèves et les étudiants, aux mécanismes
enzymatiques et aux caractéristiques stéréochimiques des macromolécules. Ceci
peut déjà se faire sur les micro-ordinateurs actuels, par la visualisation des
molécules en 3 dimensions dans le but de les comparer, de visualiser les sites
actifs, les parties hydrophobes, hydrophiles, les régions présentant une
antigénicité possible.
Références :
- ALBERTS B. et al. : Biologie Moléculaire de la Cellule. Interéditions, 1988.
- DOOLITTLE R.F. (ed.) : Molecular Evolution : Computer Analysis of Protein and Nucleic
Acid Séquences. Methods in Enzymology, Vol 183, Académie Press Inc., 1990.
- GENERMONT J. : Les Mécanismes de l'Evolution. Dunod, 1990.
- KAPLAN J.C., DELPECH M. : Biologie Moléculaire et Médecine. Flammarion, 1989.
- LESK A.M. (Ed.) : Computational Molecular Biology. Sources and Methods for Séquence
Analysis. Oxford University Press, 1988.
- PATTERSON C. : Molécules and Morphology in Evolution : Conflict or Compromise ?
Cambridge University Press, 1988.
- SAITOU N., NEI M. : Mol. Biol. Evol., 4, 4 0 6 , 1 9 8 7 .
- Société Française de Systématique : L'Analyse Cladistique. Problèmes et Solutions
Heuristiques Informatisées. Biosystema 2 , 1 9 9 0 .
- T A S S Y P. (coordonné par) : L'Ordre et la Diversité du Vivant. Nouvelle Encyclopédie des
Sciences et des Techniques, Fayard, 1989.
- WATSON J. et al. : Biologie Moléculaire du Gène. Interéditions, 1990.
P u b l i c a t i o n s spécifiques d u travail :
- HERVE J.C., THERRIE B., SALAME N. : Enseignement de la génétique moléculaire avec
des logiciels professionnels d'analyse de séquences. L'informatique scientifique dans
l'enseignement de la biologie-géologie au lycée. INRP, 1991, p. 123-130.
- PHILIPPE H., LECOINTRE G. : Evolution moléculaire : un logiciel pédagogique pour la
construction de phylogénies. L'informatique scientifique dans l'enseignement de la biologiegéologie au lycée. INRP, 1991, p. 131-138.
- H E R V E J.C., THERRIE B., S A L A M E N. : Utilisation d'une banque de données
moléculaires et d'un logiciel de traitement (SEQAIDII) en première A. Echanges, CRDP de
Versailles, 1992, p. 12-20.
I n f o r m a t i o ns p r a t i q u e s :
- PC/GENE (PC) distribué par Genofit SA, Case Postale 239, 1212 Grand-Lancy, Genève.
- GENEPRO (PC) distribué par Riverside Scientific Entreprises, 18332, 57th av. NE, Seattle,
Washington 98155.
- GENJOCKEY (PC) distribué par GEOCOM, 2 rue Niepce, Paris.
- DNASTRIDER (Mac) écrit par C. Marck, service de biochimie, CEA, 91191 Gif-sur-Yvette.
- CLUSTALV (PC), D.G. Higgins, P.M. Sharp, Department of Genetics, Trinity Collège,
Dublin 2, Ireland.
- MULTALIN (PC), F. Corpet, Laboratoire de Génétique Cellulaire, INRA, DBP 27, 31326
C ASTANET TOLOS AN
- PHYLLIP (PC), J. Felsenstein, Department of Genetics SK 50, University of Washington,
Seattle, Washington, 98195, USA
- CDROM E M B L : The EMBL Data Library, Postfach 10.2209, Meyerhofstrasse 1, 6900
Heidelberg, Germany
-SEQAIDII : Logiciel "shareware". Auteurs D.D. ROUFFA et D J . R H O A D S , Biology
Division, Centre of Basic Cancer Research, Ackert Hall, Kansas State University, Manhattan,
KS, 66506.
- EVOLUTION MOLECULAIRE : H. PHILIPPE (Université Paris XI) et G. LECOINTRE
(MNHN). Commercialisé par JERIKO, 5, Boulevard Poissonnière, 75002, Paris.
Imprimerie Bialec - 54000 Nancy - d.l. 29523 - 1
er
trimestre 1993 - D'après documents fournis
ACTIVITÉS SCIENTIFIQUES INFORMATISÉES
Visualiser
- Analyser
- Modéliser
« L'évolution du Savoir universitaire conditionne celle des contenus d'enseignement des Sciences de la Vie et de la Terre, au Collège et au Lycée. Or,
les progrès dans les connaissances scientifiques sont étroitement liés au
perfectionnement des techniques d'investigation des phénomènes biologiques et géologiques, toujours complexes. La Recherche et l'Industrie font
actuellement appel à des technologies et méthodes indirectes d'exploration
et de mesure de ces phénomènes. L'ordinateur est donc le moyen d'accès
aux objets étudiés, dans de nombreux domaines.
En recherchant les transpositions possibles des applications de l'informatique
vers l'enseignement secondaire, l'INRP ouvre une voie de renouvellement
des activités pratiques et expérimentales des élèves. L'articulation entre les
connaissances de base et la maîtrise des instruments informatiques représente, en effet, une nouvelle modalité de construction de leur savoir par les
élèves, dans une attitude active de recherche des solutions à un problème
posé. Au-delà, cette recherche induit une réflexion fondamentale sur la
formation initiale des enseignants. » (R. DEMOUNEM, extrait de la Préface).
Cet ouvrage collectif rend compte des explorations concernant « la contribution de l'informatique au renouvellement des activités expérimentales en
biologie et en géologie ». Il est destiné, en premier lieu, aux enseignants de
la discipline et privilégie la description des instruments et des démarches
d'exploitation pratiques, donne une grande place aux illustrations et évite,
dans la mesure du possible, les détails techniques.
Activités Scientifiques Informatisées fournit des exemples démonstratifs de
l'efficacité des outils informatiques et de leur caractère indispensable pour
l'étude de domaines et de concepts qui sont fondamentaux pour l'enseignement des Sciences de la Vie et de la Terre.
En géophysique, les explorations ont concerné la modélisation de la subduction ; en hydrogéologie, la gestion quantitative et qualitative des nappes
d'eau ; en biologie, la gestion des ressources renouvelables, le suivi automatisé de milieux biologiques, la neurophysiologie et la biologie moléculaire.
Les domaines d'investigation ont été choisis en conciliant leur intérêt pédagogique - leur appartenance aux programmes et le caractère problématique
de leur enseignement - et la probabilité d'y rencontrer des applications
informatiques évoluées et transférables à l'éducation.
Également disponible :
• L'INFORMATIQUE SCIENTIFIQUE D A N S L'ENSEIGNEMENT DE LA
B I O L O G I E ET D E L A G É O L O G I E - Actes d u colloque organisé par
l'École N o r m a l e S u p é r i e u r e et L ' I N R P .
1991.
291 p. Réf. BT018- 130 F
Institut National de Recherche Pédagogique
29, rue d'Ulm, 75230 PARIS CEDEX 05 - Tél. (1) 46 34 90 00
ISBN : 2-7342-0352-9
Réf : 009 BT 022
150 F U.c.
Auteur
Document
Catégorie
Uncategorized
Affichages
16
Taille du fichier
10 204 KB
Étiquettes
1/--Pages
signaler